Recombinant Human Seipin (BSCL2)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Seipin, encoded by the BSCL2 gene, is a multi-pass transmembrane protein that localizes to the endoplasmic reticulum and is associated with lipid droplet biogenesis . Seipin plays a critical role in regulating lipid droplet morphology and is essential for normal adipocyte differentiation . Mutations in the BSCL2 gene are associated with several genetic disorders, including congenital generalized lipodystrophy type 2 (CGL2), Silver spastic paraplegia syndrome, distal hereditary motor neuropathy type VA, and progressive encephalopathy with or without lipodystrophy .

Table 1: General Information of Recombinant Human Seipin (BSCL2)

Gene SymbolBSCL2
Entrez Gene ID26580
Full NameBSCL2, seipin lipid droplet biogenesis associated
SynonymsGNG3LG, HMN5, PELD, SPG17
Gene Typeprotein-coding
OrganismHomo sapiens (human)
FunctionImportant for lipid droplet morphology
Associated DisordersLipodystrophy, congenital generalized, type 2; Silver spastic paraplegia syndrome; Neuropathy, distal hereditary motor, type VA; Encephalopathy, progressive, with or without lipodystrophy

Normal Function of Seipin

The BSCL2 gene provides instructions for making the seipin protein, which is located in the endoplasmic reticulum membrane . The endoplasmic reticulum is involved in modifying newly produced proteins and transporting proteins, fats, and other molecules to where they are needed . Seipin has three different isoforms, with one found in most tissues and the other two specific to the brain and nervous system . Seipin plays a critical role in the development and function of adipocytes, which are the major component of adipose tissue . It is also involved in lipid homeostasis and normal cell physiology .

Role in Lipid Droplet Biogenesis

Seipin is essential for the biogenesis of lipid droplets, which are key organelles for storing triacylglycerols in adipose tissue . Seipin deficiency can result in abnormalities in lipid droplets concerning their number and morphology, eventually leading to the loss of adipocyte tissue . Seipin is found to be enriched at the point of contact between the endoplasmic reticulum and lipid droplets, facilitating lipid transfer and stabilizing the contact between these two organelles, which is important for lipid droplet growth .

Association with Human Diseases

Mutations in the BSCL2 gene can induce various clinical consequences, including CGL2, progressive encephalopathy with or without lipodystrophy (PELD), and BSCL2-associated motor neuron diseases .

  • Congenital Generalized Lipodystrophy Type 2 (CGL2): A rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance .

  • Progressive Encephalopathy with or without Lipodystrophy (PELD): A rare genetic disorder also known as Celia’s encephalopathy .

  • BSCL2-associated motor neuron diseases: A group of motor neuron diseases that are almost all autosomal dominant .

Seipin in Other Diseases

Abnormal expression of seipin has been found in hepatic steatosis, neurodegenerative diseases, glioblastoma, stroke, and cardiac hypertrophy, implying its potential prognostic and therapeutic values in these diseases .

Seipin and Male Infertility

Studies have shown that Bscl2 knockout males are infertile with significantly reduced sperm count and motility . Seipin is highly expressed in the testis, particularly in spermatocytes and spermatids, suggesting its role in spermatogenesis . Increased spermatid apoptosis has been observed in Bscl2 knockout testis .

Seipin's Tissue-Specific Functions

Seipin appears to have tissue-specific functions . For example, in hepatocytes, BSCL2 gene deletion increases the number and size of lipid droplets, as well as the expression of genes implicated in their formation and stability . Seipin is also highly expressed in adipose tissue, brain, and testis, with its expression in the brain inversely correlated with age and positively associated with anti-oxidative stress enzymes .

Genetic Suppressors of BSCL2 Lipodystrophy

Recent research has identified genetic suppressors for a BSCL2 lipodystrophy model using Caenorhabditis elegans . A chemical mutagenesis screen identified lmbr-1, an ortholog of human limb development membrane protein 1 (LMBR1), as a suppressor gene . Mutations in lmbr-1 were found to suppress embryonic lethality and defective eggshell formation caused by altered Seipin protein, offering insights into potential genetic interactors and pathways that may regulate seipin in lipodystrophy .

Table 2: Genetic Suppressors of BSCL2 Lipodystrophy

Suppressor GeneOrtholog in HumansFunctionEffects of Mutation in C. elegans
lmbr-1Limb development membrane protein 1 (LMBR1)May regulate Seipin and modify how BSCL2 develops .Suppresses embryonic lethality and defective eggshell formation caused by altered Seipin protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BSCL2; Seipin; Bernardinelli-Seip congenital lipodystrophy type 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
BSCL2
Target Protein Sequence
MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTV SHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVN QDLGMFLVTISCYTRGGRIISTSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLE VELYADYRENSYVPTTGAIIEIHSKRIQLYGAYLRIHAHFTGLRYLLYNFPMTCAFIGVA SNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEE STPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAALLTE ANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS
Uniprot No.

Target Background

Function

Seipin (BSCL2) plays a critical role in lipid droplet (LD) biogenesis, organelles central to lipid and energy homeostasis. In conjunction with LDAF1, it defines LD formation sites within the endoplasmic reticulum (ER). Seipin is also essential for the growth and maturation of nascent LDs into larger, mature LDs. It mediates the formation and/or stabilization of ER-LD contacts, facilitating the transfer of proteins and lipids from the ER to developing LDs. Furthermore, it regulates the maturation of ZFYVE1-positive nascent LDs and the function of the RAB18-ZFYVE1 complex in mediating ER-LD contacts. Seipin binds anionic phospholipids, including phosphatidic acid, and plays a significant role in adipocyte differentiation and development.

Gene References Into Functions
  1. SH3TC2, PMP2, and BSCL2 pathogenic variants may be infrequent in Chinese Charcot-Marie-Tooth (CMT) patients. PMID: 29336362
  2. A novel Charcot-Marie-Tooth disease-associated BSCL2 gene mutation was identified in a Chinese Han population. PMID: 27862672
  3. BSCL2 gene mutations are associated with Type 2 congenital generalized lipodystrophy. PMID: 28916377
  4. SEIPIN is identified as an evolutionarily conserved regulator of microsomal GPAT. PMID: 27806294
  5. A novel BSCL2 mutation (c.213-1336_c.294+1921delinsCA, predicted to result in p.Thr72Cysfs*2) was identified in classical Berardinelli-Seip syndrome patients in northern Peru, representing a founder mutation shared by five patients from two pedigrees. PMID: 27868354
  6. Hepatic BSCL2 deficiency induces increased and expanded lipid droplets, potentially via increased SCD1 activity. PMID: 27838812
  7. Celia seipin likely plays an underappreciated role in adipocyte maturation (but not senescence), and its expression is modifiable by exogenous factors like fatty acids. PMID: 27391332
  8. Three patients exhibited characteristics of congenital generalized lipodystrophy (CGL) due to BSCL2 gene mutations. PMID: 27612026
  9. Seipin connects newly formed lipid droplets to the ER, stabilizing ER-LD contacts and facilitating protein and lipid incorporation into growing lipid droplets in human cells. PMID: 27879284
  10. Increased Celia seipin aggregation and impaired oligomerization lead to cell death; wild-type seipin may mitigate damage from mutant seipin through sequestration into mixed oligomers. PMID: 26282322
  11. BSCL2 defines the localization of adipose differentiation-related protein, impacting lipid accumulation and adipogenic differentiation. PMID: 26975546
  12. BSCL2 mutations account for a small percentage of inherited neuropathies in Taiwan, with p.R96H associated with distal hereditary motor neuropathy. PMID: 26815532
  13. Reduced brain volume and sperm count were observed in human patients with BSCL2 mutations, highlighting seipin's role in brain development and spermatogenesis. PMID: 25934999
  14. The BSCL2 S90L mutation is primarily associated with Silver syndrome. PMID: 25487175
  15. Seipin mutations at glycosylation sites disrupt lipid droplet metabolism regulation, with autophagy serving as an adaptive response to degrade abnormal lipid droplets. PMID: 25832430
  16. An overview of the genetic association of CGLs, focusing on the differential contributions of seipin domains to lipid storage and adipogenesis. PMID: 25195639
  17. A missense mutation (N88S) in BSCL2 was found in a patient with Silver syndrome. PMID: 25219579
  18. A homozygous, truncating mutation in BSCL2 suggested congenital generalized lipodystrophy. PMID: 24961962
  19. Teratozoospermia syndrome was reported in a lipodystrophic patient with compound BSCL2 mutations, with sperm defects resembling those in infertile seipin null mutant mice. PMID: 24778225
  20. Potential molecular mechanisms by which different pathogenic mutations in seipin cause severe lipodystrophy. PMID: 23989774
  21. Exon 7 skipping in BSCL2 due to the c.985C>T mutation is responsible for a novel early-onset, fatal neurodegenerative syndrome affecting the cerebral cortex and basal ganglia. PMID: 23564749
  22. BSCL2 mutation identified in a Pakistani population causing congenital generalized lipodystrophy. PMID: 23659685
  23. Analysis of the relationship between hepacivirus (HCV) and seipin suggests that the lipid droplet outer surface is crucial for HCV release. PMID: 23907395
  24. A novel polymorphism (G->T) was found in intron 4 of the BSCL2 gene in an Italian family with hereditary motor neuropathy type V. PMID: 22427291
  25. Identification of a known BSCL2 mutation in a family with Charcot-Marie-Tooth disease. PMID: 23553728
  26. Expansion of the clinical spectrum associated with BSCL2 and description of the first family with the p.S90W mutation. PMID: 23142943
  27. Mutant seipin (Bscl2) formed protein aggregates in CNS neurons of transgenic mice, causing specific loss of alpha motor neurons in the spinal cord. PMID: 23470542
  28. The role of seipin in human disease. PMID: 22474068
  29. Increased seipin expression reduced white adipose tissue mass and adipocyte/lipid droplet size. PMID: 22234369
  30. Biochemical characteristics of seipin and its missense mutants. PMID: 21957196
  31. N88S seipin mutant transgenic mice develop motor neuron disease via endoplasmic reticulum stress. PMID: 21750110
  32. Novel BSCL2 mutation in an Indian patient with congenital generalized lipodystrophy and normal intellectual ability. PMID: 18690553
  33. Heterozygous N88S missense mutation in BSCL2 detected in three patients with distal hereditary motor neuropathy type V. PMID: 20598714
  34. Italian family with Charcot-Marie-Tooth disease type 2 and pyramidal signs; affected siblings harbored the S90L mutation, confirming phenotypic variability. PMID: 20806400
  35. Japanese CGL patients with BSCL2 mutations presented with severe insulin resistance from infancy, preceding diabetes mellitus. PMID: 19438831
  36. Potential for a distinct type of distal hereditary motor neuropathy within a family carrying N88S mutations in BSCL2. PMID: 19323790
  37. Heterozygous missense mutations in BSCL2 are associated with distal hereditary motor neuropathy and Silver syndrome. PMID: 14981520
  38. Novel nonsense mutation (R275X) in seipin identified in congenital generalized lipodystrophy patients. PMID: 15126564
  39. Dominant N88S mutation in BSCL2 leads to a broad spectrum of motor neuron disorders. PMID: 15732094
  40. Two Dutch families with BSCL2 mutations and phenotypic variability, including Silver syndrome, distal HMN type II, or distal HMN type V. PMID: 16427281
  41. Reaffirmation of the clinical phenotype associated with the BSCL2 Ser90Leu mutation and description of a family with Silver syndrome and dHMN type V in Asia. PMID: 17486577
  42. The 669insA mutation in exon 4 of BSCL2 is a major genetic alteration leading to BSCL in a group of 22 patients. PMID: 17535271
  43. Only two mutations (N88S, S90L) in exon 3 of BSCL2 may lead to dHMN-V or SS phenotypes. PMID: 17663003
  44. Seipin is found at ER-lipid droplet junctions and is important for droplet morphology. PMID: 18093937
  45. Silver syndrome (related to the N88S mutation in BSCL2) has a spectrum of clinical findings. PMID: 18224579
  46. Evolutionarily conserved seipin function in phospholipid metabolism and LD formation is important in human adipogenesis. PMID: 18250201
  47. BSCL2 is an essential, cell-autonomous regulator of adipogenesis. PMID: 18458148
  48. Seipin transmembrane domains are critical for ER retention, ubiquitination, inclusion formation, and UPR activation. Seipin is expressed in spinal cord and frontal lobe cortex neurons. PMID: 18585921
  49. Italian family with dHMN and SPG17; affected members harbor the heterozygous N88S mutation in BSCL2. PMID: 18612770
  50. A new congenital generalized lipodystrophy subtype is not associated with the BSCL2 gene. PMID: 18698612
Database Links

HGNC: 15832

OMIM: 269700

KEGG: hsa:26580

STRING: 9606.ENSP00000354032

UniGene: Hs.533709

Involvement In Disease
Congenital generalized lipodystrophy 2 (CGL2); Spastic paraplegia 17, autosomal dominant (SPG17); Neuronopathy, distal hereditary motor, 5A (HMN5A); Encephalopathy, progressive, with or without lipodystrophy (PELD)
Protein Families
Seipin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet.
Tissue Specificity
Expressed in motor neurons in the spinal cord and cortical neurons in the frontal lobe (at protein level). Highly expressed in brain, testis and adipose tissue.

Q&A

What is the basic structure and cellular localization of human seipin?

Human seipin is a protein that localizes to the endoplasmic reticulum (ER) membrane. The protein traverses the membrane twice with both termini facing the cytoplasm and contains a glycosylation site in the luminal segment . Three different isoforms can be produced from the BSCL2 gene: one found in most tissues and two that are specific to the brain and peripheral nervous system .

When examining seipin's structure, it's important to note that the lumenal domains of human seipin possess a longer central helix that is hydrophobic, interacts with LDAF1, inserts into the ER bilayer, and is implicated in binding triglycerides in molecular dynamics simulations . This structural feature differs significantly from yeast seipin, which has two short helices with several charged residues that likely do not insert into the membrane .

What is the primary function of seipin in human cells?

Seipin plays a critical role in the development and function of adipocytes, which are the major component of adipose tissue. Within the endoplasmic reticulum of adipocytes, seipin is involved in the formation of lipid droplets, which are structures that store fat molecules . Research shows that seipin forms a flexible cage at lipid droplet formation sites, suggesting a structural role in organizing the process of lipid droplet biogenesis .

The protein works upstream or at the level of peroxisome proliferator-activated receptor-γ (PPARγ), enabling the latter to exert its full activity during adipogenesis . Loss of seipin function interferes with the normal transcriptional cascade of adipogenesis during fat cell differentiation, resulting in the near-total loss of fat or lipodystrophy .

How is seipin expression regulated during adipocyte differentiation?

Seipin expression is significantly upregulated during adipocyte differentiation. In standard hormone-induced adipogenesis in 3T3-L1 cells, Bscl2 mRNA shows a distinct temporal pattern of expression:

  • 25-fold increase at day 4

  • 40-fold increase at day 6

  • 70-fold increase at day 8 (when cells are fully differentiated)

Importantly, the increase in Bscl2 mRNA lags behind that of PPARγ, suggesting it functions downstream of this master regulator of adipogenesis . Unlike early adipogenic factors such as cAMP response element-binding protein, Egr2/Krox20, and lipin 1β that are induced within hours after differentiation induction, Bscl2 expression does not show significant increases in the first 48 hours of differentiation .

What are the molecular mechanisms by which seipin mutations cause lipodystrophy?

Mutations in the BSCL2 gene cause Berardinelli-Seip congenital lipodystrophy type 2, a more severe form of congenital generalized lipodystrophy characterized by an almost complete absence of adipose tissue and a high incidence of mental retardation . Most BSCL2 mutations that cause this condition either prevent cells from making any seipin or cause cells to produce a nonfunctional version of the protein .

The defective seipin disrupts normal adipocyte function, which prevents fats from being properly stored in adipose tissue. The lack of functional seipin interferes with the transcriptional cascade required for adipogenesis, working at or upstream of PPARγ . This disruption prevents preadipocytes from properly differentiating into mature, functional adipocytes capable of storing lipids.

The severity of BSCL2-associated lipodystrophy compared to other forms suggests that seipin plays an absolutely essential role in adipocyte development that cannot be compensated by other pathways, unlike the partial redundancy seen with some other lipodystrophy-associated genes.

How do the transmembrane segments of seipin contribute to its function?

Research indicates that seipin's evolutionarily conserved transmembrane (TM) segments are critical for its function in lipid droplet biogenesis. Experimental approaches involving replacement of seipin's N-terminal or both TM segments with TM helices from structurally unrelated proteins (such as human FIT2) or shuffling the sequences of the TM segments demonstrate that these domains are crucial .

When either the N-terminal or both TM segments were replaced with those from FIT2, or when the sequences of the TM segments were shuffled, the resulting chimeric proteins localized to the ER in a pattern similar to wildtype seipin but failed to rescue the lipid droplet phenotype observed in seipin deletion mutants . These mutants also failed to rescue growth phenotypes in functional assays, with only the C-terminal shuffled-TM mutant showing some residual activity .

These findings strongly suggest that the specific sequence and structure of seipin's TM segments, not just their ability to anchor the protein in the ER membrane, are essential for proper lipid droplet formation.

What is the role of seipin oligomerization in lipid droplet formation?

Seipin forms oligomeric structures that appear to be critical for its function in lipid droplet biogenesis. The lumenal domains of neighboring seipin monomers interact with each other, forming contacts between specific residues. In particular, residue R178 appears central to these interactions, forming a hydrogen bond and a salt bridge with E185 of the adjacent monomer and participating in a cation-π interaction with W186 .

To test the importance of these interactions, researchers mutated R178 to alanine and found that the mutant protein still localized normally to the ER and formed characteristic puncta comparable in intensity to the wildtype protein . This suggests that while R178 may contribute to the oligomeric structure, other interactions may compensate for its loss.

The oligomeric structure of seipin appears to form a cage-like assembly at lipid droplet formation sites, which may help coordinate the process of lipid droplet biogenesis by creating a specialized subdomain of the ER where lipids can accumulate and eventually bud off to form nascent lipid droplets.

What are the optimal expression systems for producing functional recombinant human seipin?

When expressing recombinant human seipin for functional studies, several expression systems can be considered based on the specific research questions:

  • Mammalian cell lines: 3T3-L1 preadipocytes represent an excellent model system for studying seipin's role in adipogenesis as they undergo well-characterized differentiation into adipocytes when treated with a standard hormone cocktail (typically containing dexamethasone, methylisobutylxanthine, and insulin) . HEK293 or CHO cells are also suitable for producing human seipin for structural or biochemical studies.

  • Yeast expression systems: Despite structural differences between yeast and human seipin, S. cerevisiae has been used effectively to study fundamental aspects of seipin function . Yeast systems allow for rapid genetic manipulation and are particularly useful for structure-function studies involving mutagenesis.

  • Insect cell systems: For large-scale production of recombinant seipin for structural studies, baculovirus-infected insect cells (such as Sf9 or Hi5) may provide advantages in terms of protein yield and post-translational modifications.

When designing expression constructs, it's crucial to consider the transmembrane domains and proper localization to the ER. Adding epitope tags should be done cautiously, as the N- and C-termini face the cytoplasm and modifications might interfere with function. C-terminal GFP tagging has been successfully used in several studies without disrupting localization or function .

What techniques are most effective for studying seipin-mediated lipid droplet formation?

Several complementary techniques provide comprehensive insights into seipin's role in lipid droplet formation:

  • Fluorescence microscopy: Confocal microscopy using fluorescent lipid dyes (BODIPY, Nile Red) or tagged lipid droplet proteins allows visualization of lipid droplet morphology, size, and distribution. Super-resolution techniques can provide even more detailed information about the spatial relationship between seipin and nascent lipid droplets.

  • Electron microscopy: Transmission electron microscopy provides ultrastructural details of lipid droplets and their association with the ER. Immunogold labeling can be used to precisely localize seipin relative to lipid droplets and the ER membrane.

  • Biochemical fractionation: Isolation of lipid droplets by density gradient centrifugation followed by western blotting or proteomics analysis can identify proteins associated with these structures and detect changes in their composition in seipin-deficient cells.

  • CRISPR/Cas9-mediated genome editing: Generation of seipin knockout cell lines provides a clean background for functional rescue experiments with mutant seipin variants. This approach has been used effectively to test the importance of specific domains and residues .

  • Lipidomics: Mass spectrometry-based lipidomics can quantify changes in cellular lipid composition and metabolism resulting from seipin deficiency or mutation.

How can researchers effectively model seipin-related diseases in experimental systems?

To model seipin-related diseases such as Berardinelli-Seip congenital lipodystrophy type 2, researchers have employed several approaches:

  • Patient-derived cells: Primary cells from patients with BSCL2 mutations provide the most directly relevant model. Fibroblasts can be reprogrammed into induced pluripotent stem cells (iPSCs) and then differentiated into adipocytes to study the disease phenotype.

  • Cellular models with disease-causing mutations: Introduction of disease-associated BSCL2 mutations into cell lines using CRISPR/Cas9 or expression of mutant seipin in null backgrounds allows for detailed functional studies. For example, the A185P mutation has been studied in C. elegans as a model for the human disease .

  • Animal models: Various animal models have been developed:

    • C. elegans with the seip-1(A185P) mutation shows embryonic lethality and impaired eggshell formation, providing a tractable system for genetic suppressor screens .

    • Mouse models with Bscl2 knockout or carrying human disease mutations exhibit lipodystrophy phenotypes and metabolic abnormalities similar to human patients.

    • Zebrafish models offer advantages for high-throughput drug screening.

  • Chemical mutagenesis screens: Unbiased screens in model organisms can identify genetic suppressors that restore viability or function in seipin mutant backgrounds. This approach has led to the identification of lmbr-1 as a potential modifier of seipin function .

How should researchers interpret conflicting data on seipin function across different model organisms?

When analyzing seipin function across different model systems, researchers should consider several factors to reconcile apparently conflicting results:

  • Structural divergence: There are significant structural differences between yeast, fly, and human seipin proteins. For example, the lumenal domains of human and fly seipin possess a longer central hydrophobic helix that inserts into the ER bilayer, while yeast seipin has two short helices with charged residues that likely do not insert into the membrane . These structural differences may explain functional variations observed across species.

  • Experimental context: Consider whether the experiments were performed in adipocytes, non-adipocyte cell lines, or model organisms lacking adipose tissue entirely. Seipin may have tissue-specific functions beyond its role in adipogenesis.

  • Protein expression levels: Over- or under-expression of seipin may yield different phenotypes. When interpreting studies, note whether endogenous, physiological expression levels were maintained or if the protein was overexpressed.

  • Developmental timing: In differentiation studies, the timing of seipin expression relative to other adipogenic factors is critical. Bscl2 mRNA upregulation lags behind that of PPARγ during adipogenesis , suggesting temporal specificity in its function.

  • Isoform specificity: Consider which of the three seipin isoforms was studied. One isoform is found in most tissues, while two others are specific to the brain and peripheral nervous system , potentially explaining divergent findings in neuronal versus adipose contexts.

A comprehensive interpretation should integrate findings across multiple systems while acknowledging the limitations of each model.

What are the key considerations for analyzing protein-protein interactions involving seipin?

When studying seipin's interactions with other proteins, researchers should consider:

  • Membrane localization challenges: Seipin's transmembrane domains make it challenging to study with conventional protein-protein interaction techniques. Methods optimized for membrane proteins should be employed:

    • Proximity labeling approaches (BioID, APEX)

    • Membrane-compatible co-immunoprecipitation with appropriate detergents

    • Split-ubiquitin yeast two-hybrid systems designed for membrane proteins

    • FRET/BRET for detecting interactions in living cells

  • Oligomeric state: Seipin forms oligomers, which complicates the interpretation of interaction data. Interactions may be dependent on proper oligomerization, and disrupting this structure could lead to false negatives .

  • Temporal dynamics: Some interactions may be transient or occur only during specific stages of adipogenesis or lipid droplet formation. Time-resolved approaches can capture these dynamic interactions.

  • Subcellular localization: Confirm that observed interactions occur at physiologically relevant locations (primarily the ER and lipid droplet formation sites) through microscopy-based approaches.

  • Functional validation: Beyond identifying physical interactions, researchers should validate their functional significance through mutagenesis of interaction interfaces followed by functional assays for lipid droplet formation or adipocyte differentiation.

Notable interaction partners for seipin include LDAF1 in humans, which binds to the hydrophobic central helix of seipin's lumenal domain . This interaction appears to be evolutionarily conserved and functionally important for lipid droplet formation.

How can researchers quantitatively assess the impact of seipin mutations on lipid metabolism?

Quantitative assessment of how seipin mutations affect lipid metabolism requires a multi-parametric approach:

  • Lipid droplet morphometry:

    • Measure lipid droplet size, number, and spatial distribution using automated image analysis of fluorescence microscopy data

    • Classify abnormal lipid droplet phenotypes (e.g., "supersized" droplets with radius >400 nm, as observed in some studies)

    • Calculate the coefficient of variation in lipid droplet size as a measure of homeostasis

  • Lipidomic profiling:

    • Quantify cellular triglyceride content and composition

    • Measure phospholipid species, particularly those involved in lipid droplet monolayer formation

    • Assess fatty acid profiles using gas chromatography-mass spectrometry

  • Metabolic flux analysis:

    • Trace incorporation of labeled fatty acids into triglycerides and other lipid species

    • Measure rates of triglyceride synthesis and lipolysis using pulse-chase experiments

    • Quantify fatty acid oxidation rates to assess metabolic fate of lipids

  • Gene expression analysis:

    • Monitor expression of adipogenic transcription factors (PPARγ, C/EBPα, C/EBPβ)

    • Assess lipid metabolism genes regulated by these factors

    • Compare transcriptional profiles between wildtype and mutant cells during adipogenesis

  • Functional metabolic assays:

    • Measure insulin sensitivity and glucose uptake

    • Assess lipolytic responses to β-adrenergic stimulation

    • Evaluate mitochondrial function and oxidative capacity

Statistical approaches should include multivariate analysis to identify patterns across these parameters that may not be apparent from univariate comparisons.

What are the most promising therapeutic approaches for seipin-related lipodystrophy?

Research into therapeutic strategies for BSCL2-related lipodystrophy should consider:

  • Gene therapy approaches: CRISPR/Cas9 or other gene editing technologies could potentially correct disease-causing mutations in adipocyte progenitor cells. This approach would need to target adipose tissue stem cells to ensure long-term correction.

  • Identification of genetic modifiers: Suppressor screens, like that conducted in C. elegans with the seip-1(A185P) mutation, have identified genes such as lmbr-1 that can suppress the phenotypes associated with seipin dysfunction . These genetic modifiers represent potential therapeutic targets.

  • Small molecule screening: High-throughput screens for compounds that can restore lipid droplet formation in seipin-deficient cells may identify molecules that bypass the need for functional seipin by activating alternative pathways.

  • Metabolic interventions: Since lipodystrophy leads to metabolic complications like insulin resistance and dyslipidemia, treatments targeting these downstream effects (such as insulin sensitizers, lipid-lowering agents, and leptin replacement therapy) should continue to be refined.

  • Cell-based therapies: Transplantation of functional adipocyte progenitors or mature adipocytes derived from gene-corrected induced pluripotent stem cells could potentially restore adipose tissue function.

The identification of lmbr-1 as a suppressor of seipin deficiency effects in C. elegans suggests that modulating related pathways may provide therapeutic benefit even without directly correcting the seipin defect itself.

What aspects of seipin structure-function relationships remain to be elucidated?

Despite significant progress, several key aspects of seipin structure-function relationships require further investigation:

  • Complete structural determination: While structures of the lumenal domains have been determined, a complete structure of full-length seipin including the transmembrane segments in the context of the ER membrane would provide valuable insights into its mechanism of action.

  • Lipid binding properties: The specific lipid species that interact with seipin and the binding sites involved remain incompletely characterized. Studying these interactions could clarify how seipin coordinates lipid droplet formation.

  • Oligomerization dynamics: Understanding how seipin oligomers assemble and potentially remodel during lipid droplet formation would provide mechanistic insights. Super-resolution microscopy and cryo-electron tomography could help visualize these structures in situ.

  • Tissue-specific functions: The role of seipin in non-adipose tissues, particularly in neurons (where specific isoforms are expressed) , requires further investigation to explain the neurological phenotypes observed in some patients.

  • Post-translational modifications: The regulation of seipin activity through phosphorylation, glycosylation, or other modifications remains largely unexplored but could provide insights into its regulation.

  • Evolutionary adaptations: More detailed comparative studies of seipin across species could help explain the structural differences observed between yeast, fly, and human proteins and their functional implications.

How might systems biology approaches advance our understanding of seipin's role in cellular metabolism?

Systems biology approaches offer powerful tools for understanding seipin's functions in the broader context of cellular metabolism:

  • Network analysis: Integration of proteomics, transcriptomics, and lipidomics data from seipin-deficient models can reveal how seipin dysfunction affects multiple interconnected metabolic pathways. This may identify unexpected connections between lipid metabolism and other cellular processes.

  • Mathematical modeling: Developing computational models of lipid droplet biogenesis that incorporate seipin's structural and functional properties could predict how specific mutations affect this process. These models could be validated experimentally and used to generate new hypotheses.

  • Multi-omics integration: Correlating changes in lipid profiles with alterations in the proteome and transcriptome in seipin-deficient cells can provide a comprehensive view of the molecular consequences of seipin dysfunction.

  • Tissue-level modeling: Extending analysis beyond single cells to understand how seipin-related defects in adipocytes affect whole-body metabolism through altered adipokine secretion and ectopic lipid deposition.

  • Temporal dynamics: Time-resolved analyses during adipocyte differentiation can reveal how the absence of seipin affects the sequential activation of transcriptional networks and metabolic pathways.

  • Comparative analysis across species: Systematic comparison of seipin function across model organisms can identify conserved core functions versus species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.