Recombinant Human Serine palmitoyltransferase 2 (SPTLC2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. For specific tag requirements, please inform us in advance for preferential development.
Synonyms
KIAA0526; LCB 2; LCB2; LCB2a; Long chain base biosynthesis protein 2; Long chain base biosynthesis protein 2a; Serine palmitoyl CoA transferase 2; Serine palmitoyltransferase 2; Serine palmitoyltransferase long chain base subunit 2; Serine palmitoyltransferase subunit II; Serine-palmitoyl-CoA transferase 2; SPT 2; SPT2; SPTC2_HUMAN; SPTLC 2; Sptlc2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-562
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SPTLC2
Target Protein Sequence
MRPEPGGCCCRRTVRANGCVANGEVRNGYVRSSAAAAAAAAAGQIHHVTQNGGLYKRPFN
EAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFEN
FYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLG
FARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFA
TNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQ
PRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVV
EYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQII
TSMKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIG
AFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYS
RHRLVPLLDRPFDETTYEETED
Uniprot No.
Target Background
Function
Serine palmitoyltransferase (SPT) is a heterodimer, with the LCB1/SPTLC1 subunit forming its catalytic core. The SPT complex composition dictates substrate preference. The SPTLC1-SPTLC2-SPTSSA complex strongly prefers C16-CoA substrates, while the SPTLC1-SPTLC2-SPTSSB complex shows a preference for C18-CoA substrates. SPT plays a critical role in de novo sphingolipid biosynthesis, essential for adipogenesis.
Gene References Into Functions
- Two families exhibited late-onset autosomal dominant HSAN1C due to a novel SPTLC2 variant, c.547C>T, p.(Arg183Trp), altering a conserved amino acid. PMID: 26573920
- Studies showed that all hLCB2a mutants exhibited decreased enzyme activity in the presence of ssSPTa and ssSPTb. PMID: 24175284
- SPTLC2 mutations are associated with increased deoxySL formation, causing hereditary sensory and autonomic neuropathy type 1 (HSAN1) in a familial study. PMID: 23658386
- Mutations in the SPTLC2 subunit of serine palmitoyltransferase cause hereditary sensory and autonomic neuropathy type I. PMID: 20920666
- Research suggests that SPTLC2 mutations are not a frequent cause of genetic sensory neuropathies. PMID: 12207934
- Increased transepidermal water loss triggers upregulation of serine palmitoyltransferase mRNA expression in human epidermis. PMID: 12445191
- Findings indicate that functional serine palmitoyltransferase is not a dimer but a larger complex, comprising three subunits (SPTLC1, SPTLC2, and SPTLC3) with a 480 kDa molecular mass. PMID: 17331073
- Two proteins, ssSPTa and ssSPTb, each interact with hLCB1 and hLCB2, suggesting four distinct human SPT isozymes. PMID: 19416851
Database Links
Involvement In Disease
Neuropathy, hereditary sensory and autonomic, 1C (HSAN1C)
Protein Families
Class-II pyridoxal-phosphate-dependent aminotransferase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Widely expressed.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
