Recombinant Human Serine palmitoyltransferase 3 (SPTLC3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sphingolipid Biosynthesis

  • Catalytic Activity: Recombinant SPTLC3 exhibits higher activity with medium-chain acyl-CoAs (e.g., lauroyl-CoA, myristoyl-CoA) compared to SPTLC2, which prefers longer chains .

  • Product Diversity: Overexpression in HEK293 cells increases production of C16-sphinganine and C16-sphingosine, atypical sphingoid bases linked to metabolic and cardiovascular pathologies .

  • Regulation: Substrate inhibition occurs at acyl-CoA concentrations >0.15 mM, following Michaelis-Menten kinetics .

Tissue Expression and Pathophysiological Relevance

SPTLC3 is expressed in a tissue-specific manner, with highest levels observed in:

  1. Placenta

  2. Skin

  3. Adrenal gland

  4. Testis

Disease Associations

ConditionMechanismCitation
Ischemic CardiomyopathySPTLC3 upregulation increases C16-sphingolipids, impairing mitochondrial complex I activity .
Insulin ResistanceSPTLC3-mediated ceramide biosynthesis disrupts glucose uptake in hepatocytes .
Metabolic SyndromeAltered plasma sphingolipid profiles correlate with SPTLC3 polymorphisms .

Research Tools and Applications

Recombinant SPTLC3 is utilized in:

  • Enzyme Activity Assays: Quantifying sphingoid base production via LC-MS/MS .

  • Therapeutic Target Validation: siRNA knockdown reduces cardiac fibrosis and improves survival in murine ischemic models .

  • Diagnostic Reagents:

    • Antibodies: Validated for Western blot (WB), immunohistochemistry (IHC), and immunoprecipitation (IP) .

    • ELISA Kits: Detect SPTLC3 in biological fluids with a sensitivity of 0.056 ng/ml .

Key Research Findings

  • Cardiac Metabolism: Cardiomyocyte-specific SPTLC3 depletion in mice attenuates oxidative stress and improves glucose/ketone utilization, highlighting its role in mitochondrial dysfunction .

  • Transcriptional Regulation: Hypoxia-inducible factor 1α (HIF1α) upregulates SPTLC3 under ischemic conditions, linking it to hypoxia-driven pathologies .

  • Therapeutic Potential: Inhibition of SPTLC3 reduces hepatic ceramide levels, reversing insulin resistance in vitro .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPTLC3; C20orf38; SPTLC2L; Serine palmitoyltransferase 3; Long chain base biosynthesis protein 2b; LCB2b; Long chain base biosynthesis protein 3; LCB 3; Serine-palmitoyl-CoA transferase 3; SPT 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SPTLC3
Target Protein Sequence
MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPL HVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYM RIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDES MRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPA LVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWK KILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRGVTEFFGLDPH EVDVLMGTFTKSFGASGGYIAGRKDLVDYLRVHSHSAVYASSMSPPIAEQIIRSLKLIMG LDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVPLLLYMPGKVAAFARHMLE KKIGVVVVGFPATPLAEARARFCVSAAHTREMLDTVLEALDEMGDLLQLKYSRHKKSARP ELYDETSFELED
Uniprot No.

Target Background

Function
Serine palmitoyltransferase (SPT) is a heterodimer formed with LCB1/SPTLC1, constituting the catalytic core. The composition of the SPT complex determines its substrate preference. SPT complexes containing SPTLC3 produce shorter chain sphingoid bases compared to complexes containing SPTLC2. The SPTLC1-SPTLC3-SPTSSA isozyme utilizes C12-CoA, C14-CoA, and C16-CoA as substrates, with a slight preference for C14-CoA. Conversely, the SPTLC1-SPTLC3-SPTSSB isozyme exhibits the ability to utilize a wider range of acyl-CoAs without any apparent preference.
Gene References Into Functions
  1. This study demonstrated that the association of SPTLC3insACAC (p = 0.055) with the treatment-resistant ophthalmoplegic subphenotype of myasthenia gravis. PMID: 28673556
  2. The association between the SPTLC3 rs364585 SNP and serum total cholesterol, high-density lipoprotein cholesterol, and low-density lipoprotein cholesterol levels in the Han and Jing populations was investigated. PMID: 28056980
  3. Data identified LC3B globular structures in esophageal adenocarcinoma patients strongly associated with patient outcome, regardless of treatment. PMID: 26265176
  4. Cloning and expression of the protein in tissues and cell lines were performed. PMID: 17023427
  5. Results suggest that functional serine palmitoyltransferase is not a dimer, but a more complex structure composed of three distinct subunits (SPTLC1, SPTLC2, and SPTLC3) with a molecular mass of 480 kDa. PMID: 17331073
  6. Data show that the SPTLC3 subunit generates C(16)-sphingoid bases, and that sphingolipids with a C(16) backbone constitute a significant portion of plasma sphingolipids. PMID: 19648650

Show More

Hide All

Database Links

HGNC: 16253

OMIM: 611120

KEGG: hsa:55304

STRING: 9606.ENSP00000381968

UniGene: Hs.425023

Protein Families
Class-II pyridoxal-phosphate-dependent aminotransferase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in most tissues, except peripheral blood cells and bone marrow, with highest levels in heart, kidney, liver, uterus and skin.

Q&A

What is the basic structure and function of SPTLC3?

SPTLC3 (Serine Palmitoyltransferase Long Chain Base Subunit 3) is a protein-coding gene that encodes a subunit of the serine palmitoyltransferase complex. It shares approximately 68% sequence homology with SPTLC2 and contributes to the catalytic activity of the SPT complex . The SPTLC3 subunit specifically metabolizes lauroyl- and myristoyl-CoA substrates to generate C14 and C16-sphingoid bases, thus contributing to sphingolipid diversity .

As part of the SPT complex, SPTLC3 participates in the first and rate-limiting step of de novo sphingolipid biosynthesis. The active site of the enzyme is created at the interface between SPTLC1 and either SPTLC2 or SPTLC3, with the latter subunits containing critical residues for binding the cofactor pyridoxal phosphate (PLP) .

How does SPTLC3 differ from other SPT subunits?

SPTLC3 differs from other SPT subunits in several important ways:

  • Substrate specificity: While SPTLC2 predominantly utilizes palmitoyl-CoA (C16), SPTLC3 has specificity for shorter-chain acyl-CoAs such as lauroyl-CoA (C12) and myristoyl-CoA (C14), leading to the production of distinct sphingoid bases .

  • Expression pattern: SPTLC3 expression is tissue-specific and notably lower in hematopoietic tissues compared to SPTLC2. In fact, SPTLC3 levels are almost negligible in peripheral blood mononuclear cells (PBMCs), macrophages, bone marrow, and spleen, where SPTLC2 expression is elevated to compensate .

  • Functional redundancy: SPTLC3 can functionally substitute for SPTLC2 in the SPT complex, but generates different sphingolipid profiles due to its distinct substrate preferences .

What are the known diseases associated with SPTLC3 dysfunction?

SPTLC3 dysfunction has been implicated in several pathological conditions:

  • Sensory Peripheral Neuropathy: Mutations in SPTLC3 can contribute to peripheral nervous system diseases similar to those associated with SPTLC1 and SPTLC2 mutations .

  • Cardiac Disease: SPTLC3 is induced in humans with ischemic heart failure, suggesting its involvement in cardiovascular pathology. Research indicates that SPTLC3-derived sphingolipids with a 16-carbon backbone increase in ischemic heart failure models .

  • Metabolic Disorders: As a regulator of sphingolipid metabolism, SPTLC3 dysfunction may contribute to lipotoxicity and metabolic disorders, particularly in tissues where it is highly expressed .

The pathogenic mechanisms likely involve altered sphingolipid profiles, particularly accumulation of specific ceramide species that contribute to cellular stress and apoptotic pathways .

How does SPTLC3 interact with the small subunits SSSPTA and SSSPTB to regulate SPT activity?

The SPT complex's activity is intricately regulated through interactions between its large catalytic subunits (SPTLC1, SPTLC2, SPTLC3) and small regulatory subunits (SSSPTA, SSSPTB). These interactions influence both catalytic efficiency and substrate specificity:

Research suggests that manipulating these interactions could provide targeted approaches to modulate specific sphingolipid pools for therapeutic purposes without globally disrupting sphingolipid metabolism .

What are the methodological challenges in expressing and purifying functional recombinant SPTLC3?

Producing functional recombinant SPTLC3 presents several technical challenges:

  • Protein solubility: SPTLC3, as a membrane-associated enzyme, contains hydrophobic regions that can lead to protein aggregation and inclusion body formation when expressed in typical bacterial systems. Researchers must optimize expression conditions including temperature, inducer concentration, and host strain selection .

  • Complex assembly requirements: Functional SPTLC3 requires assembly with SPTLC1 and small subunits to form an active complex. Co-expression systems may be necessary to obtain properly assembled complexes with physiological activity. Alternatively, in vitro reconstitution protocols must be developed to assemble the complex from individually purified components .

  • Post-translational modifications: Mammalian SPTLC3 undergoes post-translational modifications that may not occur in bacterial expression systems. Eukaryotic expression platforms (yeast, insect, or mammalian cells) may be required to obtain properly modified and fully functional protein .

  • Activity assessment: Quantifying SPTLC3 activity requires specialized assays that can distinguish between different acyl-CoA substrates and sphingoid base products. Isotope-labeled substrates or sophisticated mass spectrometry techniques are often necessary to accurately characterize enzymatic activity .

A typical SPT activity assay involves measuring the incorporation of [3H]-serine into 3-ketosphinganine using microsomal preparations containing the enzyme complex. The reaction mixture includes PLP as a cofactor, palmitoyl-CoA (or alternative acyl-CoA substrates), EDTA, and DTT, with product extraction and quantification by scintillation counting .

How do SPTLC3-specific sphingolipids contribute to cellular signaling pathways compared to those generated by SPTLC2?

SPTLC3-generated sphingolipids have distinct signaling properties due to their unique structure:

  • Differential receptor interactions: Sphingolipids with shorter backbones (C14, C16) generated by SPTLC3 have different biophysical properties than the conventional C18 sphingolipids produced by SPTLC2. These differences affect their interactions with target proteins, receptors, and membrane microdomains .

  • Cardiolipin implications: In cardiac tissue, SPTLC3-derived sphingolipids appear to have specific roles in mitochondrial function and cardiolipin metabolism. These interactions may explain the observed induction of SPTLC3 in ischemic heart failure, suggesting tissue-specific functions for these lipid species .

  • Cell death pathways: Evidence suggests that SPTLC3-derived sphingolipids may differently modulate apoptotic and necroptotic pathways compared to conventional sphingolipids. For instance, C16-ceramides have been linked to specific apoptotic responses in cardiac tissue during ischemic injury .

  • Inflammatory signaling: The unique sphingolipid species generated by SPTLC3 may interact differently with inflammatory signaling pathways, potentially explaining the distinct pathological outcomes observed in tissues with high SPTLC3 expression versus those dominated by SPTLC2 .

Understanding these differences is crucial for developing targeted therapeutic approaches that modulate specific sphingolipid pools without disrupting essential cellular functions.

What genetic models are most appropriate for studying SPTLC3 function in vivo?

Several genetic models have proven valuable for investigating SPTLC3 function:

  • Conditional knockout models: Since complete deletion of sphingolipid biosynthesis genes often results in embryonic lethality (as seen with SSSPTA and core SPT subunits), tissue-specific conditional knockout models are preferable. Cre-loxP systems permit targeted deletion in specific tissues or at defined developmental stages .

  • Knockdown approaches: siRNA or shRNA approaches can achieve partial reduction of SPTLC3 expression, avoiding the potential lethality of complete knockout while still revealing functional roles .

  • Transgenic overexpression: Tissue-specific overexpression of SPTLC3 can reveal gain-of-function effects and has proven particularly informative in cardiac models, where SPTLC3 upregulation mirrors disease states .

  • Point mutations: Introducing specific mutations that alter substrate specificity or catalytic efficiency can provide mechanistic insights without completely eliminating function. This approach has been particularly valuable for dissecting the roles of critical residues in the active site .

  • Chimeric transplantation models: For studying hematopoietic effects, bone marrow transplantation experiments using donor cells with altered SPTLC3 expression can reveal cell-autonomous versus non-cell-autonomous effects, similar to approaches used with other SPT subunits .

How can mass spectrometry be optimized for comprehensive analysis of SPTLC3-generated sphingolipids?

Mass spectrometry (MS) methodologies for SPTLC3-generated sphingolipids require specific optimization:

  • Sphingoid base detection: SPTLC3 produces unique sphingoid bases with C14 and C16 backbones that must be distinguished from the conventional C18 species. This requires:

    • High-resolution LC-MS/MS methods with multiple reaction monitoring (MRM)

    • Specialized chromatographic separation to resolve isomeric and isobaric species

    • Internal standards for accurate quantification of each sphingoid base variant

  • Comprehensive sphingolipidome analysis: Beyond the immediate products of SPTLC3, a complete understanding requires analyzing downstream metabolites:

    • Targeted panels should include d16-dihydrosphingosine, d16-sphingosine, and their phosphorylated forms

    • Complex sphingolipids including d16-ceramides, glycosphingolipids, and sphingomyelins

    • Ratios between different backbone lengths (d16 vs. d18 vs. d20) to assess SPTLC3 activity

  • Tissue-specific considerations: Different tissues may require adjusted extraction and separation protocols:

    • Cardiac tissue requires specific attention to mitochondrial-associated sphingolipids

    • Brain tissue needs methods optimized for highly glycosylated sphingolipids

    • Plasma samples require techniques to analyze both free and lipoprotein-associated sphingolipids

  • Integrated data analysis: Computational approaches such as pathway analysis and correlation networks help interpret the complex dataset generated, particularly important for connecting sphingolipid changes to physiological outcomes .

How is SPTLC3 being investigated in cardiovascular disease research?

SPTLC3 has emerged as a significant focus in cardiovascular research:

  • Expression in heart failure: Studies have shown that SPTLC3 is induced in humans with ischemic heart failure, suggesting a potential role in disease pathogenesis or adaptation. This upregulation correlates with increased levels of d16-dihydrosphingosine and other C16-backbone sphingolipids .

  • Myocardial ischemia models: Research indicates that SPTLC3-derived sphingolipids may contribute to cardiomyocyte death pathways following ischemia-reperfusion injury. The specific C16-sphingolipids produced by SPTLC3 appear to have distinct signaling properties in cardiac tissue .

  • Therapeutic targeting: Several approaches are being investigated to modulate SPTLC3 activity in cardiac disease:

    • Selective inhibitors of SPTLC3 that spare SPTLC2 activity

    • Gene therapy approaches to normalize SPTLC3 expression

    • Interventions targeting the downstream metabolites of SPTLC3 activity

  • Biomarker development: The unique sphingolipid profiles generated by SPTLC3 could serve as diagnostic or prognostic biomarkers for cardiac disease. For example, serum levels of certain ceramide species (C16:0, C24:0) are already known to predict adverse cardiac events .

What is the role of SPTLC3 in neurological disorders and neuropathies?

SPTLC3 has emerging importance in neurological research:

  • Sensory peripheral neuropathy: GeneCards data indicates that SPTLC3 is associated with sensory peripheral neuropathy and peripheral nervous system disease . While mutations in SPTLC1 and SPTLC2 are well-established causes of hereditary sensory and autonomic neuropathy type 1 (HSAN1), the specific role of SPTLC3 variants in neuropathies requires further investigation.

  • Neurodegenerative disorders: The involvement of sphingolipids in neurodegenerative diseases suggests potential roles for SPTLC3. For example, a gain-of-function mutation in the related small subunit ssSPTb was shown to cause a 2-fold increase in d-20 long chain bases in brain and eye tissues, leading to neurodegenerative effects in a mouse model .

  • Myelin metabolism: Since sphingolipids are critical components of myelin sheaths, SPTLC3's role in generating specific sphingolipid species may impact myelin formation and stability. This has implications for demyelinating disorders and peripheral neuropathies .

  • Neural development: The embryonic lethality observed in knockout models of core SPT components suggests essential roles in development. SPTLC3's contribution to neural development may be particularly relevant in tissues where it is preferentially expressed .

How do SPTLC3 and SPTLC2 functionally compensate for each other in different tissues?

The relationship between SPTLC2 and SPTLC3 involves complex compensatory mechanisms:

What are the most promising approaches for developing SPTLC3-specific inhibitors?

Developing SPTLC3-specific inhibitors presents both challenges and opportunities:

  • Structural basis for selectivity: SPTLC3 shares 68% homology with SPTLC2, making selective targeting challenging . Future efforts should focus on:

    • Crystal structure determination of SPTLC3 to identify unique binding pockets

    • Computational modeling to design compounds that exploit subtle structural differences

    • Fragment-based drug discovery approaches targeting SPTLC3-specific regions

  • Substrate competition strategy: Since SPTLC3 has distinct substrate preferences compared to SPTLC2, developing substrate analogs that selectively inhibit SPTLC3 represents a promising approach . These could include:

    • Modified acyl-CoA analogs based on lauroyl- or myristoyl-CoA

    • Transition state mimics specific to SPTLC3's catalytic mechanism

    • Allosteric modulators that selectively affect SPTLC3's substrate binding

  • Small subunit interactions: Targeting the interaction between SPTLC3 and small regulatory subunits (SSSPTA, SSSPTB) could provide another avenue for selective inhibition . This approach could:

    • Disrupt specific protein-protein interactions required for SPTLC3 activity

    • Alter complex assembly or stability selectively for SPTLC3-containing complexes

    • Modify the substrate specificity of the complex rather than blocking activity entirely

  • Tissue-targeted delivery: Even moderately selective inhibitors could achieve therapeutic efficacy through targeted delivery to tissues with high SPTLC3 expression, such as cardiac tissue in heart failure patients .

How might CRISPR-Cas9 genome editing be applied to study SPTLC3 function?

CRISPR-Cas9 technology offers powerful approaches for investigating SPTLC3:

  • Precise genetic models: CRISPR enables creation of:

    • Knockout models with complete SPTLC3 deletion

    • Knock-in models introducing specific mutations to alter activity or substrate specificity

    • Tagged variants for tracking protein localization and interactions

    • Conditional alleles for tissue-specific or inducible deletion

  • Regulatory element analysis: CRISPR can target:

    • Promoter and enhancer regions to understand SPTLC3 transcriptional regulation

    • UTR sequences affecting mRNA stability or translation

    • Epigenetic modifiers to explore chromatin-level regulation

  • High-throughput screening: CRISPR libraries can identify:

    • Genes that synthetically interact with SPTLC3

    • Regulatory factors that modulate SPTLC3 expression

    • Metabolic pathways dependent on SPTLC3-derived sphingolipids

  • Therapeutic development: CRISPR approaches could potentially:

    • Correct pathogenic SPTLC3 mutations in peripheral neuropathies

    • Modulate SPTLC3 expression in heart failure

    • Engineer cells with optimized sphingolipid metabolism for cell therapy applications

What are the implications of SPTLC3 research for personalized medicine approaches?

SPTLC3 research has significant potential for personalized medicine:

  • Biomarker development: SPTLC3-derived sphingolipids could serve as biomarkers for:

    • Predicting cardiovascular risk and treatment response

    • Diagnosing specific forms of peripheral neuropathy

    • Monitoring sphingolipid metabolism in response to therapy

    • Identifying patients likely to benefit from sphingolipid-targeting drugs

  • Pharmacogenomics: Genetic variations in SPTLC3 may impact:

    • Disease susceptibility and progression

    • Response to therapies targeting sphingolipid metabolism

    • Adverse effects of drugs that indirectly affect sphingolipid pathways

    • Optimal dosing of sphingolipid-modulating therapies

  • Targeted therapies: Understanding SPTLC3's role enables:

    • Development of therapies for specific SPTLC3-related pathologies

    • Precision approaches based on individual sphingolipid profiles

    • Combination strategies targeting multiple points in sphingolipid metabolism

    • Tissue-specific interventions based on SPTLC3 expression patterns

  • Risk stratification: SPTLC3 status and activity could inform:

    • Cardiovascular risk assessment beyond traditional factors

    • Identification of individuals at risk for specific neuropathies

    • Prediction of adverse metabolic consequences in various disease states

    • Personalized preventive strategies for high-risk individuals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.