Recombinant Human Serine protease hepsin (HPN)

Shipped with Ice Packs
In Stock

Description

Role in Cancer

  • Prostate Cancer: HPN is overexpressed in 90% of prostate tumors, promoting metastasis by disrupting basement membranes and activating oncogenic pathways (e.g., HGF/Met signaling) .

  • Therapeutic Target: Small-molecule inhibitors (IC50: 0.23–2.31 μM) reduce HPN-driven proteolysis and tumor growth in preclinical models . Paradoxically, excessive HPN activity induces ER stress and autophagy, limiting cancer cell viability .

Metabolic Regulation

  • Liver Metabolism: HPN enhances glycogen and lipid synthesis in hepatocytes via HGF/Met signaling. Hpn<sup>−/−</sup> mice resist diet-induced obesity and hyperglycemia .

  • Adipocyte Browning: HPN suppresses thermogenesis in brown adipose tissue by inhibiting Ucp1 expression, reducing energy expenditure .

Immune Modulation

  • Viral Susceptibility: HPN cleaves STING, suppressing type I interferon responses in hepatocytes and prostate cancer cells, increasing vulnerability to viral infections .

Renal Function

  • Uromodulin Processing: HPN mediates proteolytic cleavage of urinary uromodulin, critical for its polymerization and excretion .

In Vitro and Preclinical Studies

  • Protease Activity Assays: Recombinant HPN is used to study substrate cleavage (e.g., pro-HGF, laminin-332) using fluorogenic substrates like Boc-QRR-AMC (specific activity: >20,000 pmol/min/μg) .

  • Cancer Models: Overexpression in PC-3 prostate cancer cells induces basement membrane degradation and metastatic phenotypes .

Therapeutic Development

  • Inhibitor Screening: High-throughput screens identified inhibitors (e.g., crizotinib) targeting HPN’s proteolytic activity .

  • ER Stress Induction: Combining proteasome inhibitors (bortezomib) with ER stress agents (salubrinal) enhances cytotoxicity in HPN-overexpressing tumors .

Key Research Findings

  1. Hepsin Paradox: Low HPN expression correlates with poor cancer prognosis, while overexpression triggers proteotoxicity and ER stress, limiting tumor viability .

  2. Metabolic Disease Link: Hpn<sup>−/−</sup> mice exhibit improved lipid profiles and glucose tolerance, highlighting HPN as a potential target for diabetes .

  3. STING Suppression: HPN-mediated STING cleavage in hepatocytes reduces antiviral immunity, implicating it in chronic infections .

Challenges and Future Directions

  • Selective Inhibition: Developing HPN-specific inhibitors without off-target effects remains challenging due to structural homology with other serine proteases .

  • Clinical Translation: While preclinical data are promising, no HPN-targeted therapies have entered clinical trials as of 2025.

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on several factors, including storage conditions, buffer ingredients, storage temperature and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
HPN; TMPRSS1; Serine protease hepsin; Transmembrane protease serine 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-417
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
HPN
Target Protein Sequence
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Uniprot No.

Target Background

Function
Hepsin is a serine protease that cleaves extracellular substrates. It contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL. Hepsin plays a role in cell growth and the maintenance of cell morphology. It also participates in the proteolytic processing of ACE2. Furthermore, Hepsin mediates the proteolytic cleavage of urinary UMOD, which is essential for UMOD polymerization.
Gene References Into Functions
  1. A study demonstrated that Hepsin was downregulated in 78% of gastric cancer cases. High Hepsin expression appears to be associated with poor prognosis. These findings suggest that hepsin protein expression is a significant and independent prognostic factor for overall survival in Gastric Cancer. PMID: 27841306
  2. Genetic variations in or near the gene encoding for hepsin protein may influence the risk of bipolar disorder. The rs62122114-A allele may have a functional impact, evidenced by differential serum HPN protein expression. PMID: 28886448
  3. A significant negative association was observed between hepsin expression in endometrial carcinoma cases and tumor grade, size, and myometrial invasion. PMID: 26990747
  4. These data demonstrate that the membrane-bound serine protease hepsin is the enzyme responsible for the physiological cleavage of uromodulin. PMID: 26673890
  5. The Hepsin pathway acts in concert with the Wnt pathway to promote prostate cancer progression. PMID: 26139199
  6. Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival. PMID: 26014348
  7. Hepsin suppressed CDK11p58 internal ribosome entry site activity in prostate cancer cells by modulating UNR expression and eIF-2alpha phosphorylation. PMID: 25576733
  8. The results of this study suggest that, in Korean men, some polymorphisms in the HPN gene might be associated with the risk of developing prostate cancer. PMID: 22665141
  9. Hepsin expression is frequently up-regulated in breast cancer tissues, which is associated with tumor growth and progression. PMID: 21383634
  10. These findings suggest that the MSP/RON signaling pathway may be regulated by hepsin in tissue homeostasis and in disease pathologies, such as in cancer and immune disorders. PMID: 21875933
  11. Elevated levels of hepsin interfere with cell adhesion and viability in the context of prostate cancer as well as other tissue types, the details of which depend on the microenvironment provided. PMID: 21750652
  12. Hepsin activity was inhibited by anthralin and increased by resveratrol. PMID: 20673210
  13. Germline genetic variation of HPN does not seem to contribute to the risk of prostate cancer or prognosis. PMID: 20166135
  14. Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor. PMID: 19911255
  15. Hepsin and maspin are inversely expressed in laser capture microdissectioned prostate cancer. PMID: 12629351
  16. Hepsin is functionally linked to the hepatocyte growth factor/MET pathway, which may contribute to prostate cancer progression. PMID: 15792801
  17. A major 11-locus haplotype is significantly associated with prostate cancer, which provides further support that HPN is a potentially important candidate gene involved in prostate cancer susceptibility. PMID: 16783571
  18. The ability of hepsin to efficiently activate pro-uPA suggests that it may initiate plasmin-mediated proteolytic pathways at the tumor/stroma interface that lead to basement membrane disruption and tumor progression. PMID: 16908524
  19. Our findings suggest that the balance between hepsin and its inhibitor, HAI-2, may have prognostic value in RCC. PMID: 17309599
  20. We analyzed all the common variations using tag SNP in the HPN and LTBP4 genes for association with IA in 390 patients and 642 controls in the Dutch population. PMID: 18487557
  21. Hepsin showed potential inhibitory effects mediated by the induction of 14-3-3sigma expression, which leads to cell cycle arrest at the G2/M phase. PMID: 18698500
  22. Ln-332 may be one mechanism by which hepsin promotes prostate tumor progression and metastasis, possibly by up-regulating prostate cancer cell motility. PMID: 18784072

Show More

Hide All

Database Links

HGNC: 5155

OMIM: 142440

KEGG: hsa:3249

STRING: 9606.ENSP00000262626

UniGene: Hs.182385

Protein Families
Peptidase S1 family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Detected in liver and kidney.

Q&A

What is the molecular structure of human hepsin?

Human hepsin is a membrane-anchored, trypsin-like serine protease. The active form is typically characterized by the region from Arg45 to Leu417, with the catalytic triad containing a critical serine residue at position 353. Recombinant forms often include modifications such as a C-terminal histidine tag for purification purposes. The protein's proteolytic activity depends on this serine residue, as demonstrated in studies where the S353A mutation renders the enzyme proteolytically inactive while maintaining structural integrity . The functional domain organization includes a serine protease domain responsible for its enzymatic activity and a membrane-anchoring domain that localizes the protein to the cell surface under normal conditions.

What are the preferred substrates for hepsin?

Hepsin exhibits strong substrate specificity, particularly favoring arginine over lysine at the P1 position as determined through positional scanning-synthetic combinatorial library (PS-SCL) screens. The enzyme shows preference for threonine, leucine, or asparagine at P2, glutamine or lysine at P3, and proline or lysine at P4 positions . Among macromolecular substrates, hepatocyte growth factor (HGF) precursor is a preferred in vitro substrate for human hepsin. Studies have confirmed this specificity using AMC (7-amino-4-methylcoumarin)-tetrapeptides that correspond to the identified cleavage sequences . Synthetic substrates like tert-butoxycarbonyl-Gln-Arg-Arg-7-amino-4-methylcoumarin (Boc-QRR-AMC) are commonly used for measuring hepsin activity in laboratory settings, with active recombinant hepsin typically demonstrating specific activity >20,000 pmol/min/μg under optimized conditions .

How is recombinant human hepsin typically produced?

Recombinant human hepsin can be produced using molecular cloning techniques with expression vectors containing the human hepsin cDNA sequence. The process typically involves:

  • Cloning the full-length hepsin cDNA into a suitable expression vector

  • Site-specific mutagenesis if producing variants (e.g., the proteolytically inactive S353A mutant)

  • Transfection into host cells (bacterial, insect, or mammalian depending on requirements)

  • Protein expression, typically with inducible systems

  • Purification using affinity chromatography, often facilitated by histidine tags

Commercial preparations of recombinant human hepsin typically include the region Arg45-Leu417, sometimes with specific mutations such as Asp161Glu and Arg162Lys, and frequently feature a C-terminal histidine tag to facilitate purification . For research applications requiring carrier-free preparations, special formulations without bovine serum albumin (BSA) are available to enhance experimental control .

How can hepsin enzymatic activity be measured in laboratory settings?

Hepsin enzymatic activity can be quantified using fluorogenic peptide substrates like Boc-QRR-AMC. The workflow typically includes:

  • Prepare recombinant hepsin at appropriate concentrations in assay buffer

  • Add the fluorogenic substrate (e.g., Boc-QRR-AMC)

  • Measure the release of AMC (excitation 380nm, emission 460nm) over time using a fluorescence microplate reader

  • Calculate specific activity in pmol substrate cleaved per minute per μg enzyme

When comparing wild-type hepsin with mutant variants like the proteolytically inactive S353A, this assay confirms that the catalytic serine at position 353 is essential for enzymatic function . For cellular assays, pericellular protease activity can be assessed using quenched-fluorescent substrates added to intact cells expressing different levels of hepsin, revealing how expression levels correlate with proteolytic activity .

What methods are used to develop proteolytically inactive hepsin mutants for control experiments?

The development of proteolytically inactive hepsin mutants for use as experimental controls primarily involves site-directed mutagenesis of the catalytic triad. The protocol typically involves:

  • Design of phosphorylated primers that introduce a point mutation at serine 353 to alanine (S353A)

  • PCR-based site-directed mutagenesis using a template containing the wild-type hepsin cDNA

  • Intramolecular ligation of the PCR product and transformation into E. coli

  • Selection and verification of mutant clones by DNA sequencing

  • Subcloning into appropriate expression vectors for mammalian cell transfection

As described in the literature, this approach has been successfully employed to generate the HPN S353A mutant that maintains structural integrity but lacks proteolytic activity . This mutant serves as an essential control to distinguish between effects dependent on hepsin's enzymatic activity versus those resulting from its physical presence or protein-protein interactions independent of catalytic function.

What experimental systems are available for studying hepsin's role in cancer progression?

Several experimental systems are available for studying hepsin's role in cancer progression:

  • Inducible expression systems: Cell lines like PC3L1-HPN provide tetracycline/doxycycline-inducible expression of wild-type hepsin, allowing researchers to control expression levels precisely. Corresponding isogenic lines expressing the proteolytically inactive S353A mutant (PC3L1-HPN S353A) enable comparative studies to discern the importance of enzymatic activity .

  • Viability assays: Cell Titer Blue assays can measure cell viability in response to varying levels of hepsin expression. This approach has revealed that high levels of wild-type hepsin, but not the S353A mutant, reduce viability in prostate cancer cell lines .

  • Xenograft models: Tumor xenografts with inducible hepsin expression systems allow in vivo assessment of hepsin's impact on tumor growth, progression, and autophagic activity through analysis of markers like LC3B punctae frequency .

  • Confocal microscopy: This technique enables visualization of hepsin localization and its colocalization with critical cellular markers such as LC3B punctae and the autophagy cargo receptor p62/SQSTM1 .

These systems collectively provide comprehensive tools for studying hepsin's complex roles in cancer biology from molecular to organism levels.

What is the "hepsin paradox" in cancer research?

The "hepsin paradox" describes a seemingly contradictory observation in cancer research: while hepsin is frequently overexpressed in primary prostate cancers and has been implicated in promoting tumor progression through basement membrane degradation, low (rather than high) expression of hepsin is associated with poor survival in several cancer types, including breast cancer, renal cell carcinoma, and hepatocellular carcinoma . Additionally, prostate cancer metastases show significantly reduced to absent hepsin expression compared to primary tumors .

This paradox is further evidenced by laboratory findings where transgenic overexpression of hepsin causes growth suppression, increased cell death, and reduced invasive growth in various cancer cell lines . The contradiction suggests that precise temporal and spatial regulation of hepsin expression is critical for tumor progression, where moderate increases may promote cancer development, but excessive expression becomes detrimental to cancer cells . Recent research indicates this paradox is directly linked to hepsin's proteolytic activity, as adverse effects only occur with catalytically active hepsin but not with the proteolytically deficient S353A mutant .

How does hepsin expression level affect cancer cell phenotypes?

Hepsin expression levels produce distinct cellular phenotypes in cancer cells, with effects that vary based on expression strength:

Low expression levels:

  • Associated with a stem-like expression signature of surface markers and adhesion molecules

  • Enhanced Notch intracellular domain release

  • Increased pericellular protease activity

  • Potential promotion of oncogenic signaling and stemness properties

High expression levels (wild-type hepsin only, not S353A mutant):

These findings suggest a dose-dependent effect where optimal levels of hepsin activity may promote cancer progression, while excessive proteolytic activity triggers cellular stress responses that become detrimental to cancer cells.

What is the relationship between hepsin and the c-Met receptor signaling pathway?

Hepsin has a significant relationship with the c-Met receptor signaling pathway through its ability to cleave and activate the hepatocyte growth factor (HGF), which is the ligand for the c-Met receptor. Research has identified HGF precursor as a preferred in vitro substrate for human hepsin . The proteolytic activation of HGF by hepsin potentially enables the activated HGF to bind to the c-Met receptor, initiating signaling cascades that promote cell proliferation, survival, and motility.

In tumors where hepsin expression is dysregulated, this relationship may influence tumorigenesis through inappropriate activation and/or regulation of HGF receptor (c-Met) functions . The specificity of hepsin for HGF is supported by substrate profiling studies showing that the enzyme's preferred cleavage sequences align with those present in the HGF precursor. Additionally, the extracellular inhibitors of HGF activator, HAI-1 and HAI-2, are also potent inhibitors of hepsin activity (with IC₅₀ values of 4±0.2 nM and 12±0.5 nM respectively), further suggesting a regulatory connection between these pathways .

How does excess hepsin proteolytic activity trigger cellular stress responses?

Excess hepsin proteolytic activity triggers multiple cellular stress response pathways through mechanisms that have been elucidated in recent research. When wild-type hepsin (but not the proteolytically inactive S353A mutant) is overexpressed, it triggers:

  • Unfolded protein response (UPR): Overexpression of proteolytically active hepsin induces expression and nuclear translocation of CHOP (C/EBP homologous protein), a transcription factor activated during ER stress. This indicates that excess hepsin activity disrupts protein folding homeostasis in the endoplasmic reticulum .

  • ER-associated protein degradation (ERAD): The cell attempts to manage the stress by activating ERAD pathways to eliminate misfolded or excess proteins .

  • Autophagy induction: Increased autophagic flux is observed with enhanced LC3B punctae formation and colocalization of hepsin with both LC3B and the autophagy cargo receptor p62/SQSTM1. This suggests autophagy is activated as a protective mechanism to clear damaged cellular components .

  • Proteotoxicity: When protein degradation pathways become overwhelmed, proteotoxic stress occurs. This is particularly evident when multiple protein quality control systems are simultaneously inhibited (e.g., combining inhibitors of the ubiquitin-proteasome pathway with either ER stress or autophagy inhibitors) .

These findings suggest that cancer cells with high hepsin expression become dependent on protein degradation pathways for survival, creating a potential therapeutic vulnerability.

What is the significance of hepsin relocalization in cancer cells?

This relocalization appears to be:

  • A direct response to excess proteolytic activity

  • Part of a cellular stress management strategy

  • A mechanism to remove potentially harmful excess active enzyme from the cell surface

  • Associated with increased autophagic flux

The significance of this relocalization lies in its role as a potential marker of proteotoxic stress in cancer cells. It indicates a shift from hepsin's normal functions in extracellular matrix degradation and growth factor activation to becoming a cellular liability that requires compartmentalization and eventual degradation. This relocalization may partially explain the reduced detection of hepsin in advanced cancers and metastases, as the protein might become less detectable by conventional immunohistochemical methods when internalized and targeted for degradation .

How do inhibitors of protein degradation pathways interact with hepsin overexpression?

Inhibitors of protein degradation pathways have complex interactions with hepsin overexpression that reveal critical dependencies in cancer cells. Research has shown that:

  • Single pathway inhibition:

    • Inhibitors of ER stress (e.g., salubrinal) or secretory protein trafficking provide slight increases in viability during hepsin overexpression, suggesting these pathways contribute moderately to hepsin-induced toxicity .

    • Individual inhibition of autophagy (e.g., bafilomycin A1) shows limited impact on cell viability during hepsin overexpression.

  • Combined pathway inhibition:

    • Simultaneous inhibition of the ubiquitin-proteasome pathway (using bortezomib) together with either ER stress (using salubrinal) or autophagy (using bafilomycin A1) causes significant decreases in viability specifically in cells overexpressing wild-type hepsin .

    • This synergistic toxicity is not observed in cells expressing the proteolytically inactive hepsin mutant (S353A).

These findings indicate that hepsin-overexpressing cancer cells become dependent on multiple, complementary protein quality control systems to manage proteotoxic stress. When these systems are compromised simultaneously, the cells can no longer cope with the burden of excess hepsin activity, leading to cell death. This creates a potential therapeutic vulnerability that could be exploited for the treatment of hepsin-overexpressing tumors through combination therapies targeting protein degradation pathways .

What factors affect the stability and activity of recombinant human hepsin in experimental settings?

Several factors can influence the stability and activity of recombinant human hepsin in laboratory settings:

For optimal activity maintenance, recombinant hepsin should be handled according to supplier recommendations, typically involving storage in buffers containing stabilizers, minimal exposure to room temperature, and avoidance of repeated freeze-thaw cycles.

How can researchers control hepsin expression levels in experimental models?

Precise control of hepsin expression levels is critical for experimental studies, particularly given the dose-dependent effects observed in cancer cells. Several approaches can be employed:

  • Inducible expression systems:

    • Tetracycline/doxycycline-inducible systems allow tight control of expression by varying inducer concentration

    • The Flp-recombinase target site (FRT) system enables site-specific integration for isogenic cell line generation

    • Expression can be titrated by adjusting doxycycline concentration (e.g., 0-250 ng/ml) to achieve desired protein levels

  • Transient transfection:

    • Variable plasmid concentrations can achieve different expression levels

    • Time-course experiments following transfection can capture different expression phases

  • Viral vectors:

    • Lentiviral or adenoviral systems with different multiplicities of infection (MOI) provide varying expression levels

    • Selection of promoters with different strengths enables baseline expression control

  • CRISPR-Cas9 gene editing:

    • Knock-in of hepsin variants under endogenous promoters maintains physiological regulation

    • Modification of endogenous regulatory elements can alter expression levels

For quantitative studies examining dose-dependent effects, the tetracycline-inducible system used in PC3L1-HPN and PC3L1-HPN S353A cell lines provides the most precise control, allowing researchers to correlate biological outcomes with specific hepsin expression levels .

What considerations are important when designing experiments to study the "hepsin paradox"?

When designing experiments to investigate the "hepsin paradox," researchers should consider the following key factors:

  • Expression level control:

    • Use inducible systems with multiple inducer concentrations to cover the full spectrum from low to high expression

    • Include western blot or flow cytometry quantification to precisely document expression levels

    • Monitor expression over time to account for potential changes in protein stability

  • Protease activity verification:

    • Always include the proteolytically inactive mutant (S353A) as a control

    • Measure enzymatic activity using fluorogenic substrates to confirm the functionality of wild-type hepsin

    • Consider including protease inhibitors (e.g., HAI-1, HAI-2, or AEBSF) as additional controls

  • Cellular context:

    • Test effects in multiple cell lines representing different stages of cancer progression

    • Consider the influence of the extracellular matrix, as it can partially revert hepsin-induced phenotypes

    • Account for endogenous hepsin expression in the chosen cell lines

  • Comprehensive phenotypic analysis:

    • Assess multiple endpoints beyond viability (e.g., invasion, migration, stemness markers)

    • Examine subcellular localization changes using confocal microscopy

    • Investigate activation of stress response pathways (UPR, ERAD, autophagy)

  • In vivo validation:

    • Use xenograft models with inducible hepsin expression

    • Compare primary tumors with metastases for hepsin expression patterns

    • Consider patient samples from different disease stages to validate clinical relevance

By addressing these considerations, researchers can develop robust experimental designs that capture the complex, dose-dependent effects of hepsin in cancer and help resolve the apparent paradox between its tumor-promoting and tumor-suppressing activities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.