Recombinant Human Serine protease HTRA2, mitochondrial (HTRA2)

Shipped with Ice Packs
In Stock

Description

Mitochondrial Protein Quality Control

HTRA2 degrades misfolded proteins in the mitochondrial intermembrane space (IMS), preventing aggregation and maintaining respiratory complex stability . Loss-of-function mutations (e.g., A141S, G399S) impair protease activity, leading to:

  • Accumulation of unfolded proteins in the IMS .

  • Increased mitochondrial ROS and reduced membrane potential .

  • Neurodegeneration, as seen in Mnd2 mice and Parkinson’s disease (PD) patients .

Apoptosis and Cell Death Pathways

HTRA2 regulates multiple cell death modalities:

PathwayMechanismSource
ApoptosisBinds XIAP, displacing caspases (caspase-dependent) or cleaves cytosolic substrates (caspase-independent)
ParthanatosProtease-independent scaffolding role downstream of PARP-1 activation
NecroptosisPro-necroptotic functions under stress, though mechanisms remain unclear

Key Research Findings

  • Parkinson’s Disease: PD-associated mutations (A141S, G399S) reduce HTRA2 protease activity, exacerbating mitochondrial dysfunction .

  • Alzheimer’s Disease: Elevated active HTRA2 correlates with acetylcholinesterase activity, choline acetyltransferase (ChAT), and neurotrophic factors (BDNF, NGF) .

  • Parthanatos: HTRA2 deletion protects cells from PARP-1-induced death, while reconstitution restores sensitivity .

Experimental Tools and Assays

ApplicationMethodologySource
Apoptosis StudiesCo-culture with XIAP-BIR2 to reverse caspase inhibition (e.g., Caspase-7 assays)
Mitochondrial StressMitoSOX/JC-1 staining to measure ROS and membrane potential
Protease InhibitionUCF-101 blocks protease activity but not chaperone functions in Plasmodium

Therapeutic Implications

  • PD/AD Therapies: Targeting HTRA2 phosphorylation (e.g., via PINK1) or protease activity may alleviate mitochondrial stress .

  • Antimalarial Research: Plasmodium falciparum HTRA2 (PfHTRA2) knockdown disrupts mitochondrial development, suggesting potential targets .

Table 1: HTRA2 Mutations and Disease Associations

MutationEffect on ActivityDisease LinkSource
A141SReduced proteaseParkinson’s disease
G399SReduced proteaseParkinson’s disease
P143AHyperphosphorylationParkinson’s disease

Table 2: HTRA2 in Neurodegenerative Diseases

DiseasePathological RoleSource
Parkinson’sLoss of mitochondrial quality control, striatal neuron loss
Alzheimer’sCorrelation with ChAT, BDNF, and α7-nAChR expression in AD brains

Table 3: Cell Death Pathways Modulated by HTRA2

PathwayProtease DependencyKey Downstream TargetsSource
ApoptosisYesXIAP, cytosolic substrates
ParthanatosNoPARP-1, mitochondrial proteins

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HTRA2; OMI; PRSS25; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2; HtrA2; Omi stress-regulated endoprotease; Serine protease 25; Serine proteinase OMI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
134-458
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLI VTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSI LAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRT QSQLAVQIRRGRETLTLYVTPEVTE
Uniprot No.

Target Background

Function
Recombinant Human Serine protease HTRA2, mitochondrial (HTRA2) is a serine protease exhibiting non-specific proteolytic activity against substrates such as beta-casein. It promotes or induces cell death through two mechanisms: 1) direct binding and inhibition of BIRC proteins (inhibitor of apoptosis proteins, IAPs), leading to increased caspase activity; and 2) a BIRC-independent, caspase-independent mechanism dependent on its serine protease activity. HTRA2 also cleaves and promotes the degradation of THAP5 during apoptosis. Isoform 2 appears to be proteolytically inactive.
Gene References Into Functions
  1. In vitro and immunohistochemical analyses showed that repeated cisplatin treatment downregulates HtrA2 protein expression in ovarian serous cancer cell lines, both before and after cisplatin-based chemotherapy. PMID: 29168038
  2. Elevated circulating HtrA2 levels in STEMI patients indicate ischemia-reperfusion injury. PMID: 28602551
  3. HTRA2 plays a significant role in programmed cell death. PMID: 27696117
  4. HTRA2 has been implicated in the pathogenesis of Parkinson's and Alzheimer's diseases. (Review) PMID: 26965693
  5. The first report of recessive deleterious mutations in human HTRA2 reveals an association between its absence and a severe neurodegenerative disorder in infancy, characterized by abnormal mitochondria, 3-methylglutaconic aciduria, and increased apoptosis sensitivity. PMID: 27208207
  6. HTRA2 and ANO3 mutations are uncommon causes of essential tremor. PMID: 27881096
  7. Under stress conditions, HtrA2 induces vimentin cleavage in wild-type and SH-SY5Y cells transfected with ABP containing the Alzheimer's disease-associated Swedish mutation. The interaction between Omi/HtrA2 and vimentin influences mitochondrial distribution in neurons. PMID: 25288153
  8. The α5 helix of the PDZ domain is involved in both intra- and inter-subunit interactions, suggesting a crucial role in HtrA2 activation. PMID: 26702898
  9. A study examined the association of the HTRA2 p.G399S mutation with essential tremor (ET) and Parkinson's disease (PD) in Asians, finding it rare and not a major contributor to either pure ET, PD, or coexistent ET and PD. PMID: 25791756
  10. The NG2 proteoglycan protects oligodendrocyte precursor cells against oxidative stress through interaction with OMI/HtrA2. PMID: 26340347
  11. Omi/HtrA2 overexpression promotes hepatocellular carcinoma cell apoptosis; the ped/pea-15 expression level accounts for the difference in Omi/HtrA2 pro-apoptotic marker levels across various hepatocellular carcinoma cell lines. PMID: 25484138
  12. HtrA2 may promote apoptosis in non-small cell lung cancer (NSCLC) cells, suggesting its potential as an NSCLC therapeutic target. PMID: 25086674
  13. Radiation-inducible gene therapy targeting HtrA2 shows promise as a more effective and specific treatment for uveal melanoma due to its spatial and temporal control via exogenous radiation. PMID: 24606398
  14. HtrA2 expression predicts chemotherapy sensitivity and may be a molecular target in high-grade serous ovarian cancer treatment. PMID: 25628093
  15. In some families, the HTRA2 p.G399S mutation is associated with hereditary essential tremor, with homozygotes developing Parkinson's disease. PMID: 25422467
  16. PARK13 and PINK1 are subcellularly specific but dynamic proteins with a reciprocal molecular relationship. PMID: 24798695
  17. HTRA2 sequence variants are infrequent in Taiwanese Parkinson's disease (PD) patients; while the HTRA2 R36W variant may contribute to PD risk in some cases, HTRA2 does not play a major role in PD pathogenesis. PMID: 24337630
  18. A novel N-terminal ligand-mediated allosteric switch is essential for transforming HtrA2 into a proteolytically competent state through a PDZ-independent, yet synergistic activation process. PMID: 24698088
  19. Downregulation of Omi/HtrA2 may contribute to the anti-atherosclerotic effect of shear stress by preventing endothelial cell apoptosis. PMID: 23123883
  20. The proteases HtrA2 and UCHL1 regulate TNF-induced necroptosis. PMID: 24090154
  21. The N-terminal region, oligomerization, and PDZ-protease interactions are crucial for active-site formation, enzyme-substrate complex stabilization, and HtrA2 function. PMID: 23608143
  22. HTRA2-regulated protein quality control in the mitochondrial intermembrane space maintains mitochondrial homeostasis. PMID: 23242108
  23. Platelets possess a functional intrinsic apoptotic signaling pathway involving the pro-apoptotic protease Omi/HtrA2 and its target protein XIAP. PMID: 23306356
  24. HtrA2 deficiency causes mtDNA damage through ROS generation and mutation, leading to mitochondrial dysfunction and cell death in aging cells. PMID: 23542127
  25. A novel non-canonical selective binding pocket in HtrA2 initiates signal propagation to the active site via a complex allosteric mechanism. PMID: 23457469
  26. Hepatocellular carcinoma cells require Omi/HtrA2 expression for apoptosis; Omi/HtrA2 may be an important prognostic marker for primary hepatocellular carcinoma. PMID: 23682386
  27. Omi/HtrA2 expression is inversely correlated with HIF-1α expression in hepatocellular carcinoma. PMID: 22490291
  28. A novel anti-apoptotic E3 ubiquitin ligase ubiquitinates antagonists of IAPs, including SMAC, HtrA2, and ARTS. PMID: 23479728
  29. HIF-1α suppresses hepatocellular carcinoma cell apoptosis by inhibiting Omi/HtrA2 expression and upregulating Bcl-2 expression, preventing Omi/HtrA2 release from the mitochondria. PMID: 23581228
  30. HtrA2 deficiency in non-neuronal tissues does not cause early lethality but leads to increased mtDNA deletion accumulation and premature aging. PMID: 22976834
  31. HtrA2 and HtrA3-S expression levels are higher in thyroid malignant tumors compared to normal and benign tissues. PMID: 22923201
  32. At low multiplicity of infection (MOI), cytomegalovirus-associated programmed cell death terminates productive infection through a pathway triggered by the mitochondrial serine protease HtrA2/Omi. PMID: 23159167
  33. HtrA2/Omi exhibits a protective role in 6-OHDA-induced cell death by regulating endoplasmic reticulum stress-related proteins. PMID: 22246992
  34. Low HtrA2 expression and high WT1 expression are strongly associated with acute leukemia development. PMID: 22391154
  35. Under cell stress, the mitochondrial protein HtrA2/Omi can activate Matrix metalloproteinase-3 in the cytosol, leading to dopaminergic neuronal cell death. PMID: 22265821
  36. Melatonin inhibits Bax expression and the cytoplasmic release of omi/HtrA2 induced by rotenone. PMID: 21883444
  37. HtrA2 and Cdk5 interact in human and mouse cell lines and brain tissue. PMID: 21701498
  38. Novel HTRA2 variants were identified in Chinese Parkinson's disease (PD) patients: the IVS5+29T>A variant may be a PD risk factor (P<0.05), while the c.G77A variant might be a pathogenic mutation. PMID: 21338583
  39. Cells carrying the HTRA2 Pro143Ala variant exhibit significantly higher rates of mitochondrial dysfunction and apoptosis compared to wild-type cells. PMID: 21701785
  40. HtrA2-mediated cleavage of UCH-L1 plays a role in regulating the balance between cell growth and cell death. PMID: 22001920
  41. Syk promotes EBV+ B cell lymphoma survival through PI3K/Akt activation, preventing HtrA2-dependent XIAP loss. Syk, Akt, and XIAP antagonists could be potential therapeutic targets for PTLD. PMID: 21908615
  42. Under intermembrane space (IMS) stress, ROS overproduction and AKT phosphorylation trigger estrogen receptor (ER) activity, upregulating NRF1 and the IMS protease HTRA2. PMID: 21486948
  43. Densely accumulated HtrA2/Omi immunoreactivity is observed intracellularly and extracellularly in the cerebral cortex and hippocampus of Alzheimer's disease patients. PMID: 20938363
  44. HtrA2 is weakly expressed in small lymphocytic lymphoma and diffuse large B-cell lymphoma. PMID: 21732781
  45. A large association study found no strong overall association between Omi/HtrA2 variants and Parkinson's disease across diverse populations. PMID: 20036034
  46. Melatonin's protective effect partly involves inhibition of peroxynitrate-mediated nitrosative stress, restoring mitochondrial HtrA2-PED signaling balance and preventing endothelial cell death. PMID: 21198825
  47. A case-control study in Sweden found a weak association between the OMI/HTRA2 A141S variant and Alzheimer's disease, but not Parkinson's disease. PMID: 21163861
  48. Omi/HtrA2 expression is associated with tumor differentiation, lymph node metastasis, and tumor stage in gastric carcinoma. PMID: 20972909
  49. Integrin α7 interacts with HtrA2 to induce prostate cancer cell death. PMID: 20651226
  50. HtrA2/Omi accumulates in motor neuronal inclusions in both sporadic and SOD1-linked familial amyotrophic lateral sclerosis (ALS), suggesting its involvement in ALS pathogenesis. PMID: 20202124
Database Links

HGNC: 14348

OMIM: 168600

KEGG: hsa:27429

STRING: 9606.ENSP00000258080

UniGene: Hs.469045

Involvement In Disease
3-methylglutaconic aciduria 8 (MGCA8); Parkinson disease 13 (PARK13)
Protein Families
Peptidase S1C family
Subcellular Location
Mitochondrion intermembrane space. Mitochondrion membrane; Single-pass membrane protein. Note=Predominantly present in the intermembrane space. Released into the cytosol following apoptotic stimuli, such as UV treatment, and stimulation of mitochondria with caspase-8 truncated BID/tBID.
Tissue Specificity
Isoform 1 is ubiquitous. Isoform 2 is expressed predominantly in the kidney, colon and thyroid.

Q&A

What is HTRA2 and what are its primary biological functions?

HTRA2 (High Temperature Requirement Protein A2) is a mitochondrial serine protease with versatile biological functions. It serves as an important regulator of apoptosis and is essential for neuronal cell survival and mitochondrial homeostasis. The protein is primarily localized in the intermembrane space of mitochondria where it functions as a chaperone molecule by monitoring and controlling protein folding . HTRA2 is involved in apoptotic regulation through its ability to degrade inhibitor-of-apoptosis proteins (IAPs) . The immature form of HTRA2 is anchored to the inner mitochondrial membrane by a transmembrane motif and is released as an active 36-kDa protein fragment through autocatalytic processing .

What is the domain architecture of HTRA2?

HTRA2 comprises several functional domains and binding motifs that contribute to its activity and regulation:

  • Mitochondrial N-terminal localization signal (MLS)

  • Transmembrane segment (TM)

  • Inhibitor of apoptosis (IAP)-binding motif (IBM)

  • Serine protease domain containing the catalytic triad

  • PDZ domain for protein-protein interactions

The interaction between these domains, particularly between the PDZ and protease domains, is critical for regulating HTRA2's proteolytic activity. Disruption of the PDZ/protease interaction through engagement with specific peptide ligands can significantly enhance HTRA2's proteolytic activity .

How is HTRA2 implicated in neurodegenerative diseases?

HTRA2 appears to be a key player in neurodegenerative diseases. Loss of HTRA2 protease function causes neurodegeneration, while overactivation of its proteolytic function is associated with cell death and inflammation . Interestingly, HTRA2 protein activity is increased in brain tissues of Alzheimer's disease patients and is thought to promote neuroprotection by enhancing autophagic processes . Additionally, increased HTRA2 activity promotes the degradation of mutant proteins (e.g., A53T α-synuclein) through autophagy and may be an important mechanism for amyloid plaque removal in Alzheimer's disease .

How do divalent ions modulate HTRA2 activity and what are the implications for experimental design?

Different divalent ions have distinct effects on HTRA2's proteolytic activity, which is crucial to consider when designing experiments. Calcium (Ca²⁺) significantly enhances HTRA2 activity by doubling the Vmax value and decreasing the KM value by about 50% compared to standard buffer conditions. This results in approximately a fourfold increase in kcat/kM value .

Magnesium (Mg²⁺) has a different effect: it lowers the KM value to about 25% of that in standard buffer but markedly decreases Vmax, resulting in an almost twofold increase in kcat/kM . In contrast, zinc (Zn²⁺) and copper (Cu²⁺) completely inhibit protease activity .

The molecular basis for calcium's effect involves shifting HTRA2 toward a "pre-open" state, facilitating easier access for activating peptides to binding sites buried at the PDZ:protease domain interface, resulting in reduced dissociation constants .

What roles do structural dynamics play in HTRA2 activation and how can researchers investigate them?

HTRA2 undergoes complex structural dynamics that are crucial for its activation. Key regions involved in these dynamics include:

  • The amino-terminal helix α1, which plays a previously unknown role in the HTRA2 activation cascade

  • The PDZ domain, which experiences metal ion-modulated dynamics

  • Regions of high structural frustration, particularly helices α1 and α5 and the LA loop, which experience micro-to-millisecond conformational exchange in the apo state

Researchers can investigate these dynamics using multiple complementary techniques:

  • Paramagnetic relaxation enhancement (PRE) experiments to track domain movements

  • Multi-quantum (MQ) CPMG relaxation rate measurements to assess differences in dynamics between apo and peptide-bound states

  • Analysis of local structural frustration to identify hotspots of highly frustrated regions that correlate with conformational exchange

These approaches have revealed that calcium binding destabilizes the domain interface, leading to partial opening, while the addition of activating peptides causes more substantial conformational changes throughout the protein .

How do allosteric mechanisms regulate HTRA2 activity and how might this inform therapeutic strategies?

HTRA2 activity is regulated through complex allosteric mechanisms including:

  • Transient oligomerization and interprotomer cooperativity

  • Metal ion binding (particularly Ca²⁺) that modulates PDZ domain dynamics

  • Peptide binding at the PDZ:protease domain interface

  • Conformational changes in regulatory loops, particularly involving helices α1 and α5

Understanding these mechanisms provides potential therapeutic targets:

  • Synthetic peptides like ASGYTFTNYGLSWVR can bind HTRA2 with high affinity and trigger neuroprotection in glaucoma models

  • Modulating HTRA2 activity through specific peptide ligands or small molecules that target allosteric sites could provide therapeutic benefits in neurodegenerative diseases

  • Targeting structural elements involved in activation (e.g., helix α1 or α5) might offer new approaches to control HTRA2 activity in disease contexts

What are effective strategies for studying HTRA2-protein interactions in retinal tissue?

Co-immunoprecipitation (Co-IP) coupled with mass spectrometry provides an effective approach for studying HTRA2 interactions in retinal tissue. A methodological protocol based on published research includes:

  • Prepare homogenized retinal tissue (e.g., from house swine, Sus scrofa)

  • Add recombinant HTRA2 with a C-terminal 6xHis-tag motif to the homogenate

  • Use HisPur Ni-NTA magnetic beads to capture the recombinant HTRA2 and its interaction partners

  • Include appropriate controls and experimental groups:

    • Control homogenate (CTRL group)

    • Homogenate with recombinant HTRA2 (HTRA2 group)

    • Homogenate with recombinant HTRA2 and UCF-101 inhibitor (UCF-101 group)

    • Homogenate with recombinant HTRA2 and synthetic CDR peptide (CDR group)

This approach allows for the identification of direct protein interaction partners of HTRA2 in retinal tissue and the evaluation of how these interactions are influenced by inhibitors or activators .

How can researchers effectively measure HTRA2 proteolytic activity in experimental settings?

Researchers can employ fluorescence-based assays to quantitatively measure HTRA2 proteolytic activity. Key methodological considerations include:

  • Use of fluorescent substrates that enable continuous monitoring of proteolytic activity

  • Testing with varying substrate concentrations to determine kinetic parameters (kcat/KM)

  • Inclusion of activating peptides (e.g., DD-PDZOpt) at defined concentrations

  • Careful buffer selection, including consideration of metal ion content

In standard assay buffer without additional metal ions, researchers can expect a kcat/KM of approximately 85 M⁻¹s⁻¹ when using sub-saturating concentrations of activating peptide (e.g., 50 μM DD-PDZOpt) .

For comprehensive analysis, researchers should consider performing parallel assays with:

  • Fixed substrate concentration and varying activator peptide concentration

  • Fixed activator peptide concentration and varying substrate concentration

  • Various metal ion supplementations (Ca²⁺, Mg²⁺, Zn²⁺, Cu²⁺) to understand their modulatory effects

What techniques are most informative for studying the structural dynamics of HTRA2?

Multiple complementary techniques provide insights into HTRA2 structural dynamics:

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Multi-quantum (MQ) CPMG relaxation rate measurements at different frequencies (e.g., 25 and 750 Hz)

    • Assessment of S²axis·τC values to characterize pico- to nanosecond timescale dynamics

    • Methyl NOE pattern analysis in full-length HTRA2

  • Paramagnetic relaxation enhancement (PRE) experiments:

    • Construction of single cysteine mutants (e.g., HTRA2 S306A, S145C)

    • Side-specific attachment of paramagnetic spin labels (MTSL)

    • Comparison of PRE effects under different conditions (apo state, metal-bound, peptide-bound)

  • Structural frustration analysis:

    • Computational analysis to identify regions of high structural frustration

    • Correlation of frustrated regions with experimental observations of conformational exchange

These techniques have revealed that regions experiencing significant micro-to-millisecond dynamics in the apo state include helices α1 and α5 and the LA loop, which correlate well with regions of high structural frustration .

How does HTRA2 dysfunction contribute to neurodegenerative diseases and what are the therapeutic implications?

HTRA2 dysfunction contributes to neurodegenerative diseases through multiple mechanisms:

  • Loss of HTRA2 protease function causes neurodegeneration, likely due to impaired protein quality control in mitochondria

  • Overactivation of HTRA2's proteolytic function is associated with cell death and inflammation

  • In Alzheimer's disease, HTRA2 protein activity is increased in brain tissues, potentially as a compensatory mechanism to promote neuroprotection through enhanced autophagy

  • HTRA2 promotes degradation of mutant proteins like A53T α-synuclein (associated with Parkinson's disease) through autophagy

These findings suggest HTRA2 may be a key therapeutic target in neurodegenerative diseases. Recent research demonstrated that a synthetic peptide (ASGYTFTNYGLSWVR) encoding the hypervariable sequence part of an antibody showed high affinity for HTRA2 and triggered neuroprotection in an in vitro organ culture model for glaucoma . This suggests that modulating HTRA2 activity—rather than simply inhibiting it—may offer therapeutic benefits.

What research approaches can help resolve the paradoxical roles of HTRA2 in neuroprotection versus neurodegeneration?

HTRA2 exhibits seemingly contradictory roles—both protecting against and potentially contributing to neurodegeneration. Research approaches to resolve this paradox include:

  • Tissue-specific and disease-stage-specific profiling of HTRA2 activity and expression

  • Identification and characterization of endogenous regulators of HTRA2 activity

  • Investigation of HTRA2's substrate specificity under different pathological conditions

  • Development of conditional knockout models to study HTRA2 function in specific cell types and at different disease stages

  • Comparative analysis of HTRA2 activity modulation across different neurodegenerative disease models

A particularly promising approach involves using modulatory peptides or small molecules that can fine-tune HTRA2 activity rather than completely inhibiting or activating it. The synthetic CDR1 peptide mentioned in the research represents such a modulator, showing neuroprotective effects in glaucoma models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.