Recombinant Human Serine-rich and transmembrane domain-containing protein 1 (SERTM1)

Shipped with Ice Packs
In Stock

Description

Definition and Gene Context

Recombinant Human SERTM1 (Serine-rich and Transmembrane Domain Containing 1) is a synthetic protein engineered through cell-free or cellular expression systems. It corresponds to the native human protein encoded by the SERTM1 gene (C13orf36), located on chromosome 13q13.3 . The protein spans 107 amino acids (AA 1–107) and features a serine-rich domain and transmembrane regions, suggesting roles in membrane interactions or signaling .

Key Gene and Protein Attributes

AttributeDetailSource
Gene ID400120
UniProt IDA2A2V5
Molecular Weight11.5 kDa
Transmembrane DomainsPredicted
Serine-Rich RegionsHigh serine content

Production and Purification

Recombinant SERTM1 is synthesized via cell-free protein synthesis (CFPS) or HEK-293 cell lines, with purification tags (e.g., Strep Tag, His tag) for affinity chromatography . The ALiCE® system, utilizing tobacco lysate, enables production of difficult-to-express proteins while maintaining post-translational modifications .

Production Systems

SystemExpression HostPurification TagPuritySource
CFPS (ALiCE®)Nicotiana tabacum lysateStrep Tag>70–80%
HEK-293 CellsHuman cellsHis tag>90%

Sequence Analysis

The recombinant protein’s sequence includes hydrophobic transmembrane regions (e.g., LLAFLLLLLI) and serine-rich motifs (e.g., SSSSSS) . The Strep Tag (e.g., WSHPQFEK) is appended for purification .

Predicted Functional Partners

Interaction data from STRING-db reveal associations with membrane-associated proteins:

PartnerFunctionInteraction ScoreSource
TMEM14AApoptosis inhibition0.489
KCNB2Potassium channel subunit0.507
CACNG4Calcium channel regulation0.488

Applications in Research

Recombinant SERTM1 is used in:

  1. SDS-PAGE/Western Blotting: Validation of antibody specificity .

  2. ELISA: Quantitative antigen detection .

  3. Functional Studies: Investigating membrane interactions and apoptosis regulation .

Control Fragment Use

A synthetic fragment (AA 11–40) is employed to block antibody binding in immunoprecipitation or immunohistochemistry experiments .

Subcellular Localization

Protein Atlas data suggest intracellular localization, possibly in organelle membranes .

Tissue Expression

Expression is enriched in brain tissues (e.g., cerebral cortex, hippocampus) .

Clinical Relevance

COSMIC analysis indicates no significant cancer-related mutations or gene fusions, suggesting limited oncogenic potential .

Challenges and Considerations

  • Solubility: Variable depending on expression system; CFPS may yield soluble proteins more reliably .

  • Functional Validation: Limited evidence of enzymatic activity; applications focus on structural studies .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration ranging from 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal stability, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SERTM1; C13orf36; Serine-rich and transmembrane domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SERTM1
Target Protein Sequence
MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLI IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS
Uniprot No.

Target Background

Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 33792

KEGG: hsa:400120

STRING: 9606.ENSP00000325776

UniGene: Hs.422375

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is SERTM1 and where is it located in the human genome?

SERTM1 (Serine-rich and Transmembrane Domain-containing Protein 1) is a protein-coding gene also known as C13orf36 . It is located on chromosome 13 at position q13.3, with specific genomic coordinates NC_000013.11 (36674020..36697839) . The gene contains 2 exons according to current annotation .

The protein is localized in intracellular membrane-bounded organelles based on recent characterization . This subcellular localization is important for understanding its potential functional roles in cellular processes.

What is the molecular structure of SERTM1?

SERTM1 is characterized by:

  • Serine-rich regions: Areas with high serine amino acid content, which are often sites for post-translational modifications

  • Transmembrane domain: A hydrophobic region that anchors the protein to cellular membranes

  • Signal sequence: Likely contains targeting information for proper cellular localization

While the complete three-dimensional structure has not been fully characterized based on available data, SERTM1 shares structural features with other serine-rich proteins that often function in protein-protein interactions and cellular adhesion .

How does SERTM1 compare to other serine-rich proteins across species?

Serine-rich proteins constitute a diverse functional group across organisms:

FeatureHuman SERTM1Bacterial SRRPsOther Eukaryotic SRPs
LocalizationIntracellular membrane-bounded organelles Cell surface/extracellular Various, often tissue-specific
Size327bp coding sequence (in some orthologs) Often large (>1000 aa)Variable
GlycosylationNot confirmed in available dataO-glycosylated on serine/threonine Often glycosylated
FunctionNot fully characterizedAdhesins, biofilm formation Various signaling and structural roles

In bacterial systems, serine-rich repeat proteins (SRRPs) are well-characterized as cell surface adhesins that contribute to pathogenesis and mediate attachment to surfaces .

How can I clone and express recombinant human SERTM1?

For successful cloning and expression of recombinant SERTM1, follow this methodological workflow:

  • Gene synthesis or amplification options:

    • Commercial gene synthesis optimized for your expression system

    • PCR amplification from human cDNA libraries using primers designed from reference sequence

    • Acquire validated ORF clones from repositories (similar to available hedgehog SERTM1 clones)

  • Vector selection considerations:

    • For mammalian expression: pcDNA3.1 series vectors are suitable

    • Include appropriate tags (His, FLAG, GFP) for detection and purification

    • Consider inducible expression systems for potentially toxic proteins

  • Expression systems:

    • Mammalian cells (HEK293, CHO) for proper post-translational modifications

    • Bacterial systems for high yield if glycosylation is not crucial

    • Cell-free systems for rapid screening

  • Expression verification methods:

    • Western blotting with tag-specific or SERTM1-specific antibodies

    • RT-PCR for transcript verification

    • Fluorescence microscopy for tagged constructs

What purification strategies are optimal for recombinant SERTM1?

Purifying transmembrane proteins like SERTM1 requires specialized approaches:

  • Membrane extraction:

    • Gentle detergents (DDM, CHAPS, Triton X-100) to solubilize from membranes

    • Buffer optimization to maintain protein stability

    • Consider nanodiscs or liposomes for maintaining native conformation

  • Chromatography workflow:

    • Affinity chromatography using expressed tags (Ni-NTA for His-tags)

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality control:

    • SDS-PAGE for purity assessment

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure verification

    • Dynamic light scattering for aggregation assessment

  • Storage considerations:

    • Glycerol addition (10-20%) for stability

    • Aliquoting to avoid freeze-thaw cycles

    • Lyophilization may be suitable depending on stability

What approaches are effective for studying SERTM1 expression patterns?

Multiple complementary techniques can characterize SERTM1 expression:

  • Transcriptomic approaches:

    • RNA-seq for quantitative expression profiling across tissues

    • Single-cell or single-nucleus RNA-seq for cellular resolution

    • smFISH (single-molecule fluorescent in situ hybridization) for spatial resolution

  • Protein detection methods:

    • Immunohistochemistry using validated antibodies

    • Western blotting for quantification across tissues/conditions

    • Proteomics for comprehensive protein identification

  • Reporter systems:

    • SERTM1 promoter-driven reporters for expression dynamics

    • CRISPR/Cas9 knock-in fluorescent tags for endogenous expression

  • Regulatory analysis:

    • SCENIC (Single-Cell Regulatory Network Inference) for regulatory network analysis

    • ChIP-seq for identifying transcription factors binding to SERTM1 promoter

How can I investigate the function of SERTM1 in cellular processes?

To elucidate SERTM1 function, implement these methodological approaches:

  • Loss-of-function studies:

    • CRISPR/Cas9 knockout or knockdown

    • siRNA/shRNA knockdown for temporal control

    • CRISPR interference for targeted repression

  • Gain-of-function studies:

    • Overexpression analysis with wild-type SERTM1

    • Domain-specific mutants to identify functional regions

    • Inducible expression systems for temporal control

  • Interaction studies:

    • Immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid or mammalian two-hybrid screening

    • Proximity labeling (BioID, APEX) for interaction networks

    • Split-GFP complementation for direct interactions

  • Functional assays:

    • Cell adhesion, migration, or proliferation assays

    • Subcellular trafficking analysis

    • Signal transduction pathway analysis

What are the predicted post-translational modifications of SERTM1 and how can I study them?

Serine-rich proteins typically undergo extensive post-translational modifications:

  • Predicted modifications:

    • O-linked glycosylation on serine residues (typical for SRRPs)

    • Phosphorylation on serine/threonine residues

    • Potentially other modifications (acetylation, ubiquitination)

  • Experimental detection methods:

    • Mass spectrometry for comprehensive PTM mapping

    • Glycoprotein-specific staining (PAS, lectin blotting)

    • Phospho-specific antibodies if available

    • Enzymatic treatments (phosphatases, glycosidases) followed by mobility shift analysis

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Comparison of modified vs. unmodified protein properties

    • Interactome analysis in presence/absence of modifications

  • Bioinformatic prediction tools:

    • NetOGlyc for O-glycosylation sites

    • NetPhos for phosphorylation sites

    • ModPred for multiple PTM prediction

How does SERTM1 potentially function in gene regulatory networks?

Understanding SERTM1's role in gene regulatory networks requires integrated approaches:

  • Network analysis:

    • SCENIC pipeline for single-cell regulatory network inference

    • Connection Specificity Index (CSI) to detect regulatory modules

    • Integration of transcription factor binding data

  • Key analytical concepts:

    • Regulon activity scores (RAS) to quantify regulatory influence

    • Target gene enrichment analysis

    • Co-expression network construction

  • Experimental validation:

    • ChIP-seq to identify direct binding targets

    • ATAC-seq to assess chromatin accessibility

    • CUT&RUN for high-resolution transcription factor binding

  • Data integration:

    • Combined analysis of gene expression, chromatin accessibility, and protein interaction data

    • Transcription factor motif enrichment analysis

    • Pathway analysis of affected genes

How should I analyze SERTM1 sequence variations across populations?

For comprehensive analysis of SERTM1 genetic variation:

  • Data acquisition:

    • Query NCBI Variation Viewer for SERTM1 variants

    • Access population databases (gnomAD, 1000 Genomes)

    • Evaluate ClinVar for clinically relevant variants

    • Extract data from dbVar for structural variants

  • Analytical workflow:

    • Variant calling from sequencing data

    • Annotation using tools like VEP, ANNOVAR

    • Functional prediction using SIFT, PolyPhen-2, CADD

    • Population frequency assessment

  • Specific considerations for SERTM1:

    • Focus on variants affecting:

      • Transmembrane domains (localization impact)

      • Serine-rich regions (modification sites)

      • Conserved functional motifs

    • Correlation with expression data when available

  • Visualization approaches:

    • Lollipop plots for variant distribution

    • Heatmaps for population frequency comparisons

    • Protein structure mapping (if available)

What bioinformatic approaches can predict SERTM1 structure-function relationships?

Employ these computational methods for SERTM1 structure-function analysis:

  • Sequence-based predictions:

    • TMHMM or TOPCONS for transmembrane domain prediction

    • InterPro and Pfam for domain identification

    • SignalP for signal peptide prediction

    • Conservation analysis across orthologs

  • Structural modeling:

    • AlphaFold2 for 3D structure prediction

    • Molecular dynamics simulations for conformational analysis

    • Comparative modeling if suitable templates exist

    • Membrane protein-specific modeling tools

  • Functional inference:

    • Gene Ontology term enrichment

    • Protein-protein interaction network analysis

    • Pathway enrichment based on interacting partners

    • Text mining of literature for functional associations

  • Integration strategies:

    • Consensus predictions from multiple methods

    • Experimental validation of key predictions

    • Iterative refinement of models with new data

How can I interpret SERTM1 localization data in the context of cellular compartments?

For accurate interpretation of SERTM1 subcellular localization:

  • Experimental approaches:

    • Immunofluorescence with organelle markers

    • Subcellular fractionation followed by Western blotting

    • Electron microscopy for high-resolution localization

    • Live-cell imaging with fluorescently tagged constructs

  • Quantitative analysis:

    • Colocalization coefficients with known markers

    • Intensity correlation analysis

    • Object-based colocalization measurements

    • Dynamic tracking for trafficking studies

  • Contextual interpretation:

    • Based on current data, SERTM1 localizes to intracellular membrane-bounded organelles

    • Consider physiological relevance of localization

    • Evaluate potential transport between compartments

    • Assess changes in localization under different conditions

  • Functional implications:

    • Correlate localization with potential interaction partners

    • Consider impact of mutations on localization

    • Evaluate role in organelle-specific processes

What is known about SERTM1 involvement in human diseases?

While specific disease associations for SERTM1 are not detailed in the available search results, researchers could investigate:

  • Genetic association approaches:

    • Analysis of variants in ClinVar database

    • GWAS data examination for disease-associated SNPs

    • Copy number variation analysis in disease cohorts

  • Expression analysis in disease:

    • Differential expression between healthy and diseased tissues

    • Single-cell analysis to identify cell type-specific alterations

    • Correlation with disease progression markers

  • Functional studies:

    • CRISPR/Cas9 editing of disease-associated variants

    • Patient-derived cell models for functional assessment

    • Animal models with SERTM1 alterations

  • Potential research directions:

    • Investigation in membrane trafficking disorders

    • Assessment in cellular adhesion pathologies

    • Evaluation in signaling pathway dysregulation

How can I design experiments to investigate SERTM1 as a potential therapeutic target?

Methodological approaches to evaluate SERTM1 as a therapeutic target:

  • Target validation:

    • Confirmation of disease-relevant expression

    • Knockdown/knockout phenotype assessment

    • Structure-function relationship characterization

  • Compound screening:

    • Development of functional assays for high-throughput screening

    • Fragment-based screening against purified protein

    • Virtual screening using computational models

    • Antibody or peptide-based targeting strategies

  • Mechanism investigation:

    • Binding site identification

    • Affinity and specificity determination

    • Effect on downstream pathways

    • Cellular phenotypic responses

  • Delivery approaches:

    • Small molecule inhibitors for transmembrane regions

    • Antibody-based therapies for accessible domains

    • RNA-based approaches for expression modulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.