Recombinant Human Short-chain dehydrogenase/reductase 3 (DHRS3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DHRS3; RDH17; SDR16C1; UNQ2424/PRO4983; Short-chain dehydrogenase/reductase 3; DD83.1; Retinal short-chain dehydrogenase/reductase 1; retSDR1; Retinol dehydrogenase 17; Short chain dehydrogenase/reductase family 16C member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
DHRS3
Target Protein Sequence
MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG RT
Uniprot No.

Target Background

Function
Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.
Gene References Into Functions
  1. Yap targets Dhrs3, to reduce retinoic acid synthesis and inhibit cardiac fibroblast differentiation during development. PMID: 29689192
  2. Mouse Dhrs3 plays critical roles in the development of the heart by controlling the formation of retinoic acid. PMID: 29447006
  3. The retinaldehyde reductase DHRS3 is essential for preventing the formation of excess retinoic acid during mouse embryonic development PMID: 24005908
  4. We proposed that four newly identified peripheral blood mononuclear cells-derived genes (DHRS3, TTC38, SAP30BP and LPIN2) could be integrated with previously reported rheumatoid arthritis (RA)-associated genes to monitor and/or diagnose RA. PMID: 28371410
  5. The bifunctional nature of the retinoid oxidoreductase complex provides the RA-based signaling system with robustness by safeguarding appropriate RA concentration despite naturally occurring fluctuations in RDH10 and DHRS3. PMID: 28232491
  6. Data indicate that retinaldehyde reductase (DHRS3) requires retinol dehydrogenase 10 (RDH10) for full enzymatic activity and, in turn, activates RDH10. PMID: 24733397
  7. p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation. PMID: 21659514
  8. The retSDR1 is identified as a novel transcriptional target of the p53 family and not transactivated by EEC syndrome-specific mutations of TAp63gamma. PMID: 20543567
  9. CST6, CXCL14, DHRS3, and SPP1 are regulated by BRAF signaling and may play a role in papillary thyroid carcinoma pathogenesis PMID: 18676742

Show More

Hide All

Database Links

HGNC: 17693

OMIM: 612830

KEGG: hsa:9249

STRING: 9606.ENSP00000365397

UniGene: Hs.289347

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with highest levels found in heart, placenta, lung, liver, kidney, pancreas, thyroid, testis, stomach, trachea and spinal cord. Lower levels found in skeletal muscle, intestine and lymph node. No expression detected in brain. In the retin

Q&A

What is the primary function of DHRS3 in retinoid metabolism?

DHRS3 functions as a negative regulator of retinoic acid (RA) signaling by catalyzing the reduction of all-trans-retinaldehyde (atRAL) to all-trans-retinol (atROL). Unlike Cyp26a1, which degrades retinoic acid directly, DHRS3 works upstream in the metabolic pathway by removing retinaldehyde, thereby reducing the substrate available for RA synthesis. This mechanism was confirmed through multiple lines of evidence, including functional studies in Xenopus embryos where overexpression of DHRS3 resulted in reduced endogenous atRA levels as measured by both luciferase reporter assays and LC-MS analysis .

Experimental evidence supporting this function includes: (1) overexpression of DHRS3 counteracted the effects of Rdh10 and Aldh1a2, which promote RA synthesis; (2) DHRS3 overexpression phenotypes could be rescued by supplementation with sub-teratogenic doses of retinaldehyde; and (3) knockdown of DHRS3 led to increased atRA concentration in morphants .

How does DHRS3 contribute to embryonic development?

DHRS3 plays a crucial role in maintaining the proper balance of retinoic acid signaling required for normal embryonic patterning and axis formation. Studies in Xenopus embryos demonstrate that DHRS3 is essential for correct anteroposterior patterning of the neural tube and formation of the body axis .

Overexpression of DHRS3 results in dose-dependent posterior truncation, similar to phenotypes induced by Cyp26a1 overexpression. This manifests as a posterior shift in the expression domains of midbrain and hindbrain markers such as en2, krox20, and hoxb3. Conversely, knockdown of DHRS3 causes an expansion of RA-responsive genes in structures like the pronephros, evidenced by expanded expression of lhx1 . These findings indicate that precise regulation of RA levels by DHRS3 is critical for proper embryonic development.

What is known about the regulation of DHRS3 expression?

DHRS3 expression appears to be regulated by retinoic acid levels in a feedback mechanism. Research using organotypic skin raft culture models has shown that treatment with either retinol (2 μM) or retinoic acid (0.1 μM) dramatically downregulates RDHE2 (SDR16C5) expression by 4-fold and 9-fold, respectively . This contrasts with the regulation of other retinoid-metabolizing enzymes, such as RDH10, which tends to be upregulated in response to elevated RA levels.

This pattern of regulation was also observed in HEK293 cells where stable silencing of DHRS3 (which increases endogenous RA levels) resulted in an 11-fold downregulation of RDHE2 transcript, while RDH10 transcript was upregulated by 1.5-fold . This differential regulation suggests complex feedback mechanisms in the retinoid metabolism pathway.

How does DHRS3 interact with other enzymes in the retinoid metabolism pathway?

DHRS3 functions within a network of enzymes involved in retinoid metabolism, with specific protein-protein interactions that enhance enzymatic activities. Research has shown that DHRS3 interacts with RDH10, and this interaction enhances the activities of both enzymes . This cooperative interaction allows for more efficient control of retinoic acid synthesis and degradation.

The functional relationship between DHRS3 and other enzymes has been demonstrated through rescue and co-expression experiments. For instance, DHRS3 overexpression reduces the phenotypes induced by Aldh1a2 overexpression in the presence of retinaldehyde, as well as phenotypes induced by Rdh10 overexpression in the presence of retinol . These findings suggest that DHRS3 acts by either removing retinaldehyde or directly inhibiting Aldh1a2 and/or Rdh10.

Interestingly, not all retinoid-metabolizing enzymes interact with DHRS3. Studies showed that RDHE2 (encoded by SDR16C5) does not appear to partner with DHRS3, as co-expression of these proteins in HEK293 cells did not affect the activity of either enzyme . This selectivity in protein interactions suggests specific structural requirements for functional cooperation in the retinoid metabolism pathway.

What methodologies are most effective for measuring DHRS3 enzymatic activity?

Several complementary methodologies have proven effective for measuring DHRS3 enzymatic activity, each with particular strengths:

  • Cell-based luciferase reporter assays: HEK293T cells transfected with retinoic acid-responsive element-driven luciferase vectors provide a sensitive method for indirectly measuring DHRS3 activity by quantifying changes in atRA concentration. This approach can detect changes in atRA concentrations ranging from 10⁻⁷ to 10⁻¹¹ M .

  • LC-MS analysis: Liquid chromatography-mass spectrometry provides direct quantification of retinoid metabolites in biological samples. Studies have shown that embryos overexpressing Aldh1a2 or injected with DHRS3 morpholinos showed 2.02-fold or 4.01-fold increases in atRA compared to controls, respectively, as measured by LC-MS .

  • In vivo phenotypic assays: Functional consequences of DHRS3 activity can be assessed by examining phenotypes in model organisms. For example, overexpression of DHRS3 causes posterior truncation and shifts in expression domains of RA-responsive genes, while knockdown leads to expansion of structures regulated by RA signaling .

  • Biochemical enzyme assays with purified proteins: Recombinant DHRS3 expressed in Sf9 insect cells and purified via affinity chromatography can be used in direct enzyme assays to determine substrate specificity and kinetic parameters .

For optimal characterization, a combination of these methods is recommended to validate findings across different experimental systems.

How can DHRS3 function be effectively manipulated in experimental systems?

Several approaches have been validated for manipulating DHRS3 function in experimental systems:

  • Overexpression studies: Injection of DHRS3 mRNA or transfection with DHRS3 expression vectors has been successfully used to increase DHRS3 activity. This approach resulted in posterior truncation in Xenopus embryos and reduced endogenous atRA levels in cell culture systems .

  • Morpholino-mediated knockdown: Antisense morpholino oligonucleotides targeting DHRS3 effectively reduce DHRS3 protein levels, resulting in increased atRA concentration in morphants . This approach is particularly useful in developmental model systems.

  • Stable gene silencing: Stable silencing of DHRS3 expression using shRNA or CRISPR-Cas9 techniques can generate models of elevated RA levels. HEK293 cells with stably silenced DHRS3 provide a useful model for studying the consequences of chronic RA excess .

  • Rescue experiments: Supplementation with retinoids can be used to validate the specificity of DHRS3 manipulation. For instance, phenotypes induced by DHRS3 overexpression were alleviated by supplementation with 0.5 μM atRAL during gastrulation .

  • Co-expression studies: Co-expressing DHRS3 with other retinoid-metabolizing enzymes allows investigation of functional interactions. This approach revealed that DHRS3 counteracts the actions of Rdh10 and Aldh1a2 .

Each approach has distinct advantages depending on the research question, with consideration needed for the developmental stage, cellular context, and specific retinoid pathway being investigated.

What are the key considerations for designing experiments to study DHRS3 function?

When designing experiments to study DHRS3 function, researchers should consider:

  • Model system selection: Different model systems offer complementary advantages. Xenopus embryos provide an excellent system for studying developmental roles, while cell culture systems like HEK293 or HepG2 cells allow for more controlled biochemical analyses .

  • Temporal dynamics: DHRS3 function is developmentally regulated, so the timing of manipulations is critical. In Xenopus studies, phenotypic consequences of DHRS3 overexpression were stage-dependent, affecting gastrulation and neurulation processes .

  • Dosage effects: DHRS3 overexpression causes dose-dependent phenotypes, indicating the importance of careful titration of expression constructs or mRNA .

  • Pathway interactions: Experiments should account for interactions with other retinoid-metabolizing enzymes. Co-expression studies with enzymes like Rdh10 and Aldh1a2 provide insights into how DHRS3 functions within the broader retinoid network .

  • Specificity controls: Rescue experiments using retinoid supplementation help verify that observed phenotypes are specific to alterations in retinoid metabolism rather than off-target effects .

  • Quantitative readouts: Both direct (LC-MS measurement of retinoids) and indirect (luciferase reporter assays, gene expression analysis) methods should be employed to comprehensively assess DHRS3 function .

What cell and tissue types are most appropriate for studying DHRS3?

The selection of appropriate cell and tissue types depends on the specific aspects of DHRS3 function being investigated:

  • Embryonic tissues: For developmental studies, neural tissue and developing pronephros have proven informative, as these tissues show clear responses to alterations in RA signaling. Expression of markers such as en2, krox20, hoxb3 (neural) and lhx1 (pronephros) provides readouts of DHRS3 activity .

  • Skin models: Organotypic skin raft cultures provide an excellent model for studying DHRS3 regulation in stratified human epidermis. These cultures closely resemble normal human skin in terms of gene expression and regulation .

  • Hepatic cells: HepG2 cells have been successfully used to study DHRS3 activity in the context of retinoid metabolism, reflecting the liver's important role in vitamin A processing .

  • Kidney-derived cell lines: HEK293 cells represent a versatile system for biochemical studies of DHRS3, including protein-protein interactions and enzymatic activity measurements .

  • Insect cells: For purification of active recombinant DHRS3 protein, Sf9 insect cells have proven effective, particularly for subsequent biochemical characterization .

Each of these systems offers distinct advantages, and researchers should select the most appropriate model based on their specific research questions about DHRS3 function.

What are the recommended protocols for assessing DHRS3-protein interactions?

To assess DHRS3-protein interactions, the following methodological approaches have been successfully employed:

  • Co-expression studies: Co-transfection of cultured cells (such as HEK293) with expression vectors for DHRS3 and potential interacting partners, followed by functional assays to detect altered enzymatic activities. This approach revealed that DHRS3 interacts with RDH10 but not with RDHE2 .

  • Co-immunoprecipitation: Using epitope-tagged versions of DHRS3 (such as FLAG-tagged or HA-tagged constructs) allows for immunoprecipitation of protein complexes and subsequent detection of interacting partners by immunoblotting.

  • Functional rescue experiments: Testing whether co-expression of DHRS3 with enzymes like Aldh1a2 or Rdh10 modifies their phenotypic effects. Such experiments showed that DHRS3 counteracts the effects of these RA-synthesizing enzymes .

  • Activity assays in intact cells: Measuring the conversion of retinol to retinaldehyde and retinoic acid in cells co-expressing DHRS3 and other retinoid-metabolizing enzymes. Co-expression of RDHE2 with RALDH1 enhanced the conversion of retinol to RA above the level observed with RALDH1 alone .

  • Subcellular co-localization studies: Examining whether DHRS3 and potential interaction partners co-localize in the same subcellular compartments, which is a prerequisite for physiologically relevant interactions.

These approaches should be used in combination to provide complementary evidence for protein-protein interactions involving DHRS3.

How should researchers optimize expression systems for recombinant DHRS3 production?

Optimization of expression systems for recombinant DHRS3 production should consider:

  • Vector selection: High-expression vectors like pCS105 have been shown to produce higher amounts of recombinant retinoid-metabolizing enzymes compared to standard expression vectors .

  • Cell type selection: Different cell types offer varying advantages for DHRS3 expression:

    • HEK293 cells: Suitable for mammalian expression with proper post-translational modifications

    • HepG2 cells: Produce detectable FLAG-tagged DHRS3 protein as verified by immunoblotting

    • Sf9 insect cells: Effective for high-level expression of enzymes that may be unstable in mammalian cells, as demonstrated with RDHE2S variants

  • Epitope tagging strategy: Adding epitope tags (FLAG, HA, His₆) facilitates detection and purification without compromising enzymatic activity. C-terminal His₆-tags have been successfully used for purification using Ni²⁺-affinity chromatography .

  • Protein stability considerations: Some retinoid-metabolizing enzymes show differential stability across expression systems. For example, RDHE2S variants were unstable in human cells but stable when expressed in insect cells .

  • Subcellular localization: Subcellular fractionation studies have shown that retinoid-metabolizing enzymes like RDHE2S variants associate with both mitochondrial (10,000 g pellet) and microsomal membranes (105,000 g pellet) . This localization should be considered when designing purification strategies.

  • Activity verification: Following expression, enzymatic activity should be verified using appropriate assays, as protein expression does not always correlate with functional activity .

What are the most sensitive methods for quantifying DHRS3-mediated changes in retinoid metabolism?

For quantifying DHRS3-mediated changes in retinoid metabolism, researchers should consider these sensitive methodologies:

  • Cell-based retinoic acid-responsive element (RARE) luciferase assays: This indirect method uses HEK293T cells transfected with RARE-driven luciferase vectors to detect changes in atRA concentration. The assay can measure changes within the range of 10⁻⁷ to 10⁻¹¹ M of atRA, making it highly sensitive for detecting subtle alterations in retinoid metabolism .

  • Liquid chromatography-mass spectrometry (LC-MS): This direct analytical method provides precise quantification of retinoids in biological samples. LC-MS analysis has successfully detected changes in endogenous atRA levels in embryos with manipulated DHRS3 expression, though the magnitude of changes was sometimes less profound than those detected by luciferase assays .

  • Quantitative PCR of RA-responsive genes: Expression levels of RA-responsive genes such as hoxd1, gbx2, and cdx4 can serve as sensitive readouts of alterations in RA signaling. This approach is particularly useful in animal cap assays and other developmental contexts .

  • In situ hybridization for spatial analysis: For developmental studies, whole-mount in situ hybridization for RA-responsive genes provides spatial information about changes in RA signaling domains. This approach revealed posterior shifts in hindbrain marker expression following DHRS3 overexpression .

  • Metabolic labeling with radiolabeled retinoids: Tracing the metabolism of radiolabeled retinol or retinaldehyde can provide kinetic information about DHRS3-mediated reactions.

For comprehensive analysis, a combination of these methods is recommended to validate findings across different experimental platforms.

How should researchers interpret contradictory data regarding DHRS3 function?

When confronted with contradictory data regarding DHRS3 function, researchers should:

What statistical approaches are most appropriate for analyzing DHRS3 functional data?

Appropriate statistical approaches for analyzing DHRS3 functional data include:

  • Student's t-test for direct comparisons: When comparing two experimental conditions (e.g., control versus DHRS3 overexpression), the t-test is appropriate for determining statistical significance. For example, comparing the sum of products (retinaldehyde plus RA) produced from retinol in RDHE2-overexpressing cells versus control cells (2.2 ± 0.17 versus 1.67 ± 0.24 nmoles/mg, p=0.035) .

  • ANOVA for multiple comparisons: When analyzing multiple experimental conditions or treatments, ANOVA followed by appropriate post-hoc tests helps control for type I errors. This is particularly relevant when comparing different combinations of retinoid-metabolizing enzymes.

  • Dose-response modeling: For experiments examining concentration-dependent effects of retinoids or DHRS3 expression, sigmoid curve fitting and calculation of EC50 or IC50 values provides quantitative parameters for comparison.

  • qPCR data analysis: For gene expression studies, the ΔΔCt method with appropriate reference genes should be employed. This approach revealed an 11-fold downregulation of RDHE2 transcript in DHRS3-silenced cells .

  • Phenotypic scoring systems: For developmental studies, quantitative scoring of phenotypic categories (e.g., normal, mild, moderate, severe) followed by chi-square analysis can assess the significance of differences between experimental groups.

  • Image analysis quantification: For spatial gene expression or protein localization data, quantitative image analysis with appropriate statistical testing provides objective assessment of pattern changes.

For all analyses, researchers should report both the magnitude of effects (with standard deviations or standard errors) and the p-values to allow proper interpretation of biological significance.

What are the current gaps in our understanding of DHRS3 function?

Despite significant progress in characterizing DHRS3, several important knowledge gaps remain:

  • Substrate specificity: While DHRS3 is known to reduce retinaldehyde to retinol, the complete range of its substrate specificity and the protein that presents the substrate to DHRS3 remain to be fully characterized .

  • Structural determinants of activity: The specific structural features that determine DHRS3 enzymatic activity and its interactions with other proteins in the retinoid metabolism pathway require further elucidation.

  • Tissue-specific functions: The role of DHRS3 may vary across different tissues and developmental stages, but comprehensive analysis across multiple tissues is lacking.

  • Regulatory mechanisms: While DHRS3 is known to be regulated by RA levels, the complete set of transcriptional, post-transcriptional, and post-translational mechanisms controlling DHRS3 expression and activity remain to be fully characterized.

  • Pathological implications: The consequences of DHRS3 dysfunction in human diseases beyond developmental disorders have not been extensively investigated.

  • Species-specific differences: Comparative analyses of DHRS3 function across species could reveal important evolutionary adaptations in retinoid metabolism.

Addressing these gaps will require interdisciplinary approaches combining structural biology, biochemistry, developmental biology, and systems biology methodologies.

What are the most promising future directions for DHRS3 research?

Future research on DHRS3 should focus on these promising directions:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.