Recombinant Human Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
SDR42E1; HSPC105; Short-chain dehydrogenase/reductase family 42E member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SDR42E1
Target Protein Sequence
MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRH LSDVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVY TSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRT CALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALR ADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFI LGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSG SRDSECFVWDGLLVFLLIIAVLMWLPSSVILSL
Uniprot No.

Target Background

Database Links

HGNC: 29834

OMIM: 616164

KEGG: hsa:93517

STRING: 9606.ENSP00000332407

UniGene: Hs.87779

Protein Families
3-beta-HSD family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SDR42E1 and what are its primary functions?

SDR42E1 (Short Chain Dehydrogenase/Reductase Family 42E, Member 1) is a protein-coding gene that belongs to the extended short-chain dehydrogenase/reductase superfamily of enzymes. Recent research has established its critical role in vitamin D biosynthesis and homeostasis. The protein functions primarily as an oxidoreductase, enabling activity on the CH-OH group of donors with NAD or NADP as acceptors . It is also involved in steroid biosynthesis processes, particularly affecting the regulation of 7-dehydrocholesterol (7-DHC) conversion to vitamin D3 . Experimental evidence from CRISPR/Cas9 knockout models demonstrates that SDR42E1 depletion results in a 1.6-fold disruption in the steroid biosynthesis pathway (P = 0.03), significantly affecting vitamin D production through accumulation of 7-DHC precursor .

Where is SDR42E1 predominantly expressed in human tissues?

Bioinformatic screening through the GTEx database reveals highest expression of SDR42E1 in sun-exposed and non-exposed skin (TPM values of 11.93 and 11.62, respectively), followed by the esophagus (TPM = 5.08) . Analysis using the ARCHS4 RNA-sequencing public resource further demonstrates that SDR42E1 exhibits highest expression in intestinal epithelial cells (TPM = 8.7) and skin keratinocytes (TPM = 8.4) . Additionally, significantly higher expression has been observed in HaCaT cells (TPM = 11.2), a spontaneously transformed aneuploid keratinocyte line from adult human skin biopsies, and the HCT116 cell line (TPM = 10), a human colorectal carcinoma cell line . This expression pattern aligns with tissues critically involved in vitamin D synthesis and metabolism.

What is the subcellular localization of SDR42E1?

Immunofluorescence studies using targeted antibodies against SDR42E1 in enriched human HaCaT cell lines have revealed that SDR42E1 localizes predominantly to the plasma membrane and cytoplasm . This localization pattern is significant as these cellular compartments are critical platforms for lipid and steroid metabolic processes. The plasma membrane and cytosolic distribution of SDR42E1 strongly suggests its involvement in regulating lipid metabolism within these cellular compartments .

What is known about the rs11542462 variant in SDR42E1?

The rs11542462 nonsense variant in SDR42E1 has been significantly associated with serum 25(OH)D levels through genome-wide association studies . This variant is located on chromosome 16q23 in exon 3 and introduces a premature stop codon, resulting in the substitution of glutamine with termination at position 30 of the protein (p.Q30*GLN>*TER) . This mutation potentially leads to a non-functional SDR42E1 enzyme. Notably, this variant has been associated with serum concentrations of vitamin D precursor, 8-DHC, which demonstrates a close relationship with 7-DHC, a crucial precursor in vitamin D synthesis . Homozygosity for this loss-of-function variant is relatively common, with research identifying 1,802 homozygous individuals in the gnomAD population .

How does SDR42E1 mutation affect human phenotypes beyond vitamin D metabolism?

A homozygous missense mutation c.461G>A (p.Arg154Gln) in SDR42E1 has been identified in a consanguineous family with affected siblings displaying a syndrome affecting both connective tissue and sexual development . Clinical examinations revealed thinning of the cornea, blue sclera, keratoconus, hyperelasticity of the skin, joint hypermobility, muscle weakness, hearing loss, and dental abnormalities compatible with brittle cornea syndrome (BCS) . Notably, affected individuals also presented with micropenis, hypospadias, and cryptorchidism, suggesting abnormalities in endocrine pathways . Endocrinological investigations further revealed low cholesterol levels in these patients . This evidence suggests SDR42E1's broader role in steroid hormone synthesis beyond vitamin D, affecting both connective tissue maintenance and sexual maturation.

Is SDR42E1 considered haploinsufficient?

According to ClinGen Dosage Sensitivity curation, SDR42E1 is classified as "Dosage Sensitivity Unlikely" with a Haploinsufficiency (HI) Score of 40 . This designation is supported by multiple lines of evidence:

  • The presence of homozygous loss-of-function (LoF) variants in >1% of the gnomAD population, including p.Gln30Ter in 1,802 homozygous individuals

  • Identification of homozygous LoF variants at >5% frequency in the 1000 Genomes Project database

  • Detection of 1,218 individuals in an Icelandic population with homozygous LoF variants in this gene

This evidence collectively suggests that heterozygous loss of SDR42E1 is unlikely to result in a clinical phenotype, and the gene tolerates loss-of-function variations reasonably well.

What cell models are most appropriate for studying SDR42E1 function?

Based on expression data and successful experimental applications, the HaCaT human keratinocyte cell line represents an optimal model for studying SDR42E1 function, particularly in relation to vitamin D biosynthesis . This selection is supported by:

  • High expression of SDR42E1 in HaCaT cells (TPM = 11.2)

  • Biological relevance of keratinocytes as the primary site of vitamin D3 biosynthesis

  • Successful implementation in previous research using CRISPR/Cas9 gene editing to study SDR42E1 function

For intestinal function studies, the HCT116 cell line (TPM = 10) may be appropriate given the high expression of SDR42E1 in intestinal epithelial cells . When selecting cell models, researchers should consider tissue-specific functions of SDR42E1 and choose models that best reflect the biological context under investigation.

How can CRISPR/Cas9 gene editing be optimized for SDR42E1 knockout studies?

For effective CRISPR/Cas9-mediated knockout of SDR42E1, researchers should consider the following methodological approach:

  • Target selection: Design guide RNAs (gRNAs) targeting exon 3 of SDR42E1 to mimic the naturally occurring p.Q30*GLN>*TER nonsense mutation

  • Cell model: Utilize HaCaT human keratinocyte cell lines for highest biological relevance

  • Validation strategy: Implement a comprehensive validation approach:

    • Genomic validation through sequencing of the target site

    • Protein-level validation through Western blotting or immunofluorescence

    • Transcriptomic validation through RT-PCR or RNA-seq

  • Multi-omics assessment: Follow knockout validation with:

    • RNA sequencing to identify differentially expressed genes

    • Proteomic analysis to confirm altered protein expression

    • Metabolomic analysis focusing on vitamin D precursors and products

This approach has been successfully implemented in recent research, revealing significant disruption in steroid biosynthesis pathways and vitamin D production in SDR42E1 knockout models .

What methodological approaches are effective for quantifying SDR42E1's impact on vitamin D biosynthesis?

A comprehensive multi-omics approach yields the most informative results when assessing SDR42E1's impact on vitamin D biosynthesis:

  • Transcriptomic analysis: RNA sequencing to identify differentially expressed genes in steroid and vitamin D biosynthesis pathways. Key genes to monitor include:

    • Upregulated genes: SERPINB2, EBP, DHCR7

    • Downregulated genes: ALPP, SLC7A5, CYP26A1

  • Proteomic analysis: Mass spectrometry-based proteomics to confirm altered protein expression patterns, particularly focusing on:

    • Increased proteins: SERPINB2, KRT17, SERPINB1

    • Decreased proteins: SLC3A2, SLC7A5, LASP1

  • Metabolite quantification: Direct measurement of vitamin D precursors and metabolites:

    • 7-dehydrocholesterol (7-DHC) accumulation

    • Vitamin D3 production using total vitamin D quantification methods (R² = 0.935, P-value = 0.0016)

  • Drug enrichment analysis: Assessment of pathway perturbation through drug enrichment analysis (P-value = 4.39 × 10⁻⁰⁶)

This comprehensive approach provides multiple lines of evidence documenting SDR42E1's impact on vitamin D biosynthesis at transcriptional, translational, and metabolic levels.

How does SDR42E1 interact with other enzymes in the vitamin D biosynthesis pathway?

SDR42E1 appears to function within a complex network of enzymes regulating vitamin D biosynthesis. Research using multi-omics approaches in SDR42E1 knockout models has revealed significant interactions with key regulators:

  • Relationship with DHCR7: SDR42E1 depletion leads to ~2-3 fold elevation of DHCR7 (P-value = 8.03 × 10⁻⁰⁹), which converts 7-DHC to cholesterol, potentially diverting 7-DHC away from vitamin D synthesis

  • Impact on CYP26A1: SDR42E1 knockout results in ~1.5-3 fold downregulation of CYP26A1 (P-value = 1.06 × 10⁻⁰⁸), a key enzyme in vitamin D metabolism

  • Connection to steroid pathway enzymes: Significant effects on EBP (P-value = 2.46 × 10⁻¹³), involved in cholesterol biosynthesis

The interaction network suggests SDR42E1 may function as a regulatory node connecting various aspects of steroid metabolism, with particular influence on the availability of 7-DHC for conversion to vitamin D3. Future research should employ protein-protein interaction studies and metabolic flux analysis to further elucidate these complex relationships.

What are the contradictions in current data regarding SDR42E1 function and how can they be resolved?

Current research presents several apparent contradictions regarding SDR42E1 function that require focused investigation:

  • Functional redundancy vs. essential role:

    • The high frequency of homozygous loss-of-function variants in general populations suggests functional redundancy

    • Yet specific mutations cause distinct phenotypes, indicating essential roles in certain contexts

    Resolution approach: Investigate tissue-specific compensatory mechanisms and conditional knockout models in different developmental stages

  • Single vs. multiple metabolic roles:

    • Some studies focus exclusively on vitamin D biosynthesis

    • Others suggest broader roles in steroid metabolism, connective tissue maintenance, and sexual development

    Resolution approach: Comprehensive metabolomic profiling across multiple steroid pathways in various tissue types

  • Subcellular localization implications:

    • Plasma membrane and cytoplasmic localization suggests certain functional roles

    • Proposed biochemical activities may require different subcellular compartmentalization

    Resolution approach: Advanced imaging techniques combined with domain-specific mutations to correlate localization with function

These contradictions highlight the need for more nuanced research approaches that consider context-dependent functions and regulatory mechanisms of SDR42E1.

What are the technical challenges in producing and purifying recombinant SDR42E1 for structural studies?

Producing and purifying recombinant SDR42E1 for structural studies presents several technical challenges:

  • Expression system selection:

    • Bacterial systems (E. coli) may lack appropriate post-translational modifications

    • Mammalian expression systems better preserve native structure but yield lower protein amounts

    • Insect cell systems represent a potential compromise between yield and proper folding

    Recommended approach: Baculovirus-infected insect cell system (Sf9 or Hi5) for initial trials

  • Solubility considerations:

    • As a membrane-associated protein , SDR42E1 may have hydrophobic regions

    • Fusion tags (MBP, SUMO) can enhance solubility

    • Detergent screening critical for extraction and purification

    Recommended approach: Test multiple fusion constructs with systematic detergent screening

  • Purification strategy:

    • Multi-step purification likely required: affinity, ion exchange, and size exclusion chromatography

    • Protein stability during concentration steps may be problematic

    • Removal of fusion tags without affecting protein stability

    Recommended approach: On-column cleavage of fusion tags followed by negative chromatography

  • Structural determination approach:

    • X-ray crystallography may be challenging due to membrane association

    • Cryo-EM increasingly viable for membrane-associated proteins

    • NMR studies for dynamics but size limitations may apply

    Recommended approach: Cryo-EM as primary method with X-ray crystallography of stable domains as complementary approach

Successful structural studies will provide critical insights into SDR42E1's catalytic mechanism and interaction surfaces.

How might single-cell technologies advance our understanding of SDR42E1 function?

Single-cell technologies offer transformative potential for understanding SDR42E1 function across diverse biological contexts:

  • Single-cell RNA sequencing (scRNA-seq):

    • Can reveal cell type-specific expression patterns of SDR42E1 within heterogeneous tissues

    • May identify previously unknown cell populations with high SDR42E1 expression

    • Could elucidate cell-specific responses to SDR42E1 perturbation

    Application framework: Compare scRNA-seq profiles between wild-type and SDR42E1-knockout skin samples to identify cell-specific transcriptional networks

  • Single-cell proteomics:

    • Emerging technologies allow protein-level analysis at single-cell resolution

    • Can validate transcriptional findings and identify post-translational regulations

    • May reveal cell-specific protein interaction partners

    Application framework: Apply mass cytometry (CyTOF) with SDR42E1-specific antibodies to quantify protein levels across skin cell populations

  • Spatial transcriptomics:

    • Preserves spatial context while providing transcriptional information

    • Can link SDR42E1 expression to tissue microenvironments and gradients

    • May reveal previously unknown region-specific functions

    Application framework: Apply Visium or Slide-seq to skin sections to correlate SDR42E1 expression with vitamin D synthesis capacity across epidermal layers

These approaches would significantly advance understanding of SDR42E1's context-dependent functions and regulatory networks.

What clinical applications might emerge from better understanding SDR42E1's role in vitamin D biosynthesis?

Advanced understanding of SDR42E1's role in vitamin D biosynthesis could lead to several promising clinical applications:

  • Personalized vitamin D supplementation strategies:

    • Genetic testing for SDR42E1 variants (particularly rs11542462) to identify individuals with impaired vitamin D biosynthesis

    • Customized supplementation regimens based on genotype

    • Potential for development of genotype-specific vitamin D analogs

  • Novel therapeutic approaches:

    • Small molecule modulators of SDR42E1 to enhance vitamin D production

    • Gene therapy approaches for rare severe mutations

    • Metabolic bypassing strategies for patients with defective SDR42E1

  • Expanded screening and diagnostic applications:

    • Integration of SDR42E1 genotyping into broader metabolic screening panels

    • Combined assessment of SDR42E1 variants with other vitamin D pathway genes

    • Development of metabolite signatures for functional SDR42E1 deficiency

  • Prevention strategies for associated conditions:

    • Early intervention in patients with SDR42E1 variants to prevent connective tissue complications

    • Monitoring and management protocols for patients with rare pathogenic mutations

    • Nutritional and environmental guidelines based on genotype

These applications represent the potential translation of basic SDR42E1 research into precision medicine approaches for vitamin D-related conditions.

How can computational approaches enhance functional prediction for uncharacterized SDR42E1 variants?

Computational methodologies offer powerful approaches for predicting the functional impact of uncharacterized SDR42E1 variants:

  • Integrated variant effect prediction:

    • Ensemble approaches combining multiple prediction algorithms (SIFT, PolyPhen, CADD, etc.)

    • Integration of evolutionary conservation, structural features, and functional domains

    • Machine learning models trained on known variant effects

    Implementation strategy: Develop SDR42E1-specific neural network incorporating protein domain knowledge

  • Molecular dynamics simulations:

    • Assessment of variant effects on protein stability and dynamics

    • Identification of altered interaction surfaces or catalytic residues

    • Prediction of changes in substrate binding affinity

    Implementation strategy: Compare wild-type and variant SDR42E1 simulations across relevant timescales (100ns-1μs)

  • Systems biology modeling:

    • Integration of variant effects into pathway models of vitamin D biosynthesis

    • Prediction of metabolic flux alterations based on enzyme kinetics

    • Multi-scale modeling linking molecular effects to tissue-level outcomes

    Implementation strategy: Develop ordinary differential equation models of vitamin D synthesis incorporating enzyme kinetics data

  • Data integration frameworks:

    • Incorporation of variant information with multi-omics data

    • Network-based approaches to identify functional modules affected by variants

    • Patient-specific modeling based on genotype and phenotype data

    Implementation strategy: Create knowledge graphs linking variants to molecular, cellular, and clinical outcomes

These computational approaches would significantly enhance our ability to interpret the growing number of SDR42E1 variants being identified through clinical sequencing.

Key Gene Expression Patterns of SDR42E1 Across Human Tissues

Tissue/Cell TypeExpression Level (TPM)Data SourceReference
Sun-exposed skin11.93GTEx database
Non-exposed skin11.62GTEx database
Esophagus5.08GTEx database
Intestinal epithelial cells8.7ARCHS4
Skin keratinocytes8.4ARCHS4
HaCaT cell line11.2ARCHS4
HCT116 cell line10.0ARCHS4

Differentially Expressed Genes in SDR42E1 Knockout HaCaT Cells

GeneExpression ChangeP-valueProposed FunctionReference
SERPINB2↑ 2-3 fold2.17 × 10⁻¹⁰³Regulates blood clot breakdown
EBP↑ 2-3 fold2.46 × 10⁻¹³Cholesterol biosynthesis
DHCR7↑ 2-3 fold8.03 × 10⁻⁰⁹Converts 7-DHC to cholesterol
ALPP↓ 1.5-3 fold<2.2 × 10⁻³⁰⁸Bone mineralization, vitamin D marker
SLC7A5↓ 1.5-3 fold1.96 × 10⁻²¹⁵Large neutral amino acid transport
CYP26A1↓ 1.5-3 fold1.06 × 10⁻⁰⁸Vitamin D metabolism

Comparative Analysis of SDR42E1 Knockout Effects on Different Biological Pathways

Biological PathwayImpact in SDR42E1 KOKey EvidenceP-valueReference
Steroid biosynthesis1.6-fold disruptionTranscriptomic pathway analysis0.03
Vitamin D productionReductionTotal vitamin D quantification0.0016 (R² = 0.935)
7-DHC metabolismAccumulationDrug enrichment analysis4.39 × 10⁻⁰⁶
Cholesterol synthesisAlteredClinical evidence of low cholesterol in patientsN/A
Connective tissue maintenanceDisruptionClinical phenotype of affected individualsN/A
Sexual developmentImpairmentClinical evidence of genital abnormalitiesN/A

Recommended Protocol for CRISPR/Cas9 Knockout of SDR42E1 in HaCaT Cells

The following protocol outlines a validated approach for generating SDR42E1 knockout in HaCaT cells based on successful implementation in recent research :

  • Guide RNA Design:

    • Target early exon regions, preferably exon 3 near the site of the natural rs11542462 variant

    • Design at least 3 guide RNAs using established tools (CHOPCHOP, CRISPOR)

    • Verify specificity using BLAST and off-target prediction algorithms

  • CRISPR/Cas9 Delivery:

    • For HaCaT cells, nucleofection (Amaxa system) shows optimal efficiency

    • Use ribonucleoprotein (RNP) complex of Cas9 protein and synthetic gRNA

    • Include GFP reporter for transfection efficiency monitoring

  • Clone Selection and Validation:

    • Perform limiting dilution to isolate single-cell derived colonies

    • Screen by PCR and Sanger sequencing to identify indels

    • Confirm knockout at protein level via Western blot

    • Perform off-target analysis at top predicted sites

  • Functional Validation:

    • Assess transcriptional changes in steroid biosynthesis pathway genes

    • Measure 7-DHC and vitamin D3 levels by LC-MS/MS

    • Compare with wild-type cells in response to UV stimulation

  • Multi-omics Analysis:

    • Perform RNA-seq using at least three biological replicates

    • Conduct proteomic analysis focusing on differentially expressed proteins

    • Integrate findings to identify affected pathways

This protocol provides a robust framework for generating reliable SDR42E1 knockout models for further functional studies.

Advanced Methods for Assessing SDR42E1 Function in Vitamin D Biosynthesis

For comprehensive assessment of SDR42E1's role in vitamin D biosynthesis, the following integrated methodological approach is recommended:

  • Photosynthesis of Vitamin D in Cell Culture:

    • Compare wild-type and SDR42E1 knockout HaCaT cells

    • Expose to controlled UV-B radiation (290–315 nm)

    • Harvest cells at multiple time points (0, 1, 3, 6, 24 hours)

    • Extract and quantify 7-DHC, pre-vitamin D3, and vitamin D3 using LC-MS/MS

  • Metabolic Labeling Studies:

    • Use deuterated cholesterol precursors to trace metabolic pathway

    • Apply pulse-chase methodology to track conversion rates

    • Quantify labeled intermediates and end products

    • Calculate flux rates through the pathway

  • Enzyme Activity Assays:

    • Express and purify recombinant SDR42E1

    • Assess oxidoreductase activity using NAD(P)H fluorescence

    • Test activity with various potential substrates

    • Determine kinetic parameters (Km, Vmax, kcat)

  • Protein Interaction Studies:

    • Perform immunoprecipitation followed by mass spectrometry

    • Validate key interactions by co-immunoprecipitation

    • Map interaction domains through truncation mutants

    • Visualize interactions using proximity ligation assay

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.