Recombinant Human Signal peptidase complex subunit 2 (SPCS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
SPCS2; KIAA0102; SPC25; Signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
SPCS2
Target Protein Sequence
AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK
Uniprot No.

Target Background

Function

Component of the microsomal signal peptidase complex responsible for removing signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.

Database Links

HGNC: 28962

KEGG: hsa:9789

STRING: 9606.ENSP00000263672

UniGene: Hs.282700

Protein Families
SPCS2 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the role of SPCS2 in the signal peptidase complex?

SPCS2 serves as a regulatory subunit of the signal peptidase complex (SPC), which consists of four evolutionarily conserved membrane subunits (Spc1–3 and Sec11). While not directly responsible for the catalytic activity of the complex, SPCS2 plays a crucial role in modulating substrate discrimination and cleavage site selection . The protein helps sharpen the discrimination between signal peptides (SPs) and signal-anchored (SA) sequences, enhancing the complex's specificity .

Methodologically, researchers investigating SPCS2 function typically employ deletion mutants or site-directed mutagenesis to evaluate its contribution to SPC activity. Pulse-labeling experiments are particularly valuable for capturing the early stages of protein maturation in the endoplasmic reticulum, allowing quantification of signal sequence processing efficiency in the presence or absence of functional SPCS2 .

How does human SPCS2 differ from its yeast homolog Spc2?

When conducting comparative studies, researchers should note that while signal peptides of secretory precursors can be efficiently processed in the absence of Spc2 in yeast systems, the requirements may differ in human cells . Experimental approaches utilizing complementation assays, where human SPCS2 is expressed in yeast Spc2 deletion strains, can provide valuable insights into conserved and divergent functions.

What experimental systems are available for studying recombinant human SPCS2?

Several experimental systems have been developed for studying recombinant human SPCS2:

  • Bacterial expression systems: E. coli-based expression of specific SPCS2 domains (particularly soluble portions) for structural studies and antibody production

  • Yeast complementation systems: Expression of human SPCS2 in Spc2 deletion strains to assess functional conservation

  • Mammalian cell culture: Transient or stable expression of tagged SPCS2 variants for localization, interaction, and functional studies

  • In vitro translation systems: Supplemented with microsomes or reconstituted SPC components to study SPCS2's role in signal peptide processing

When selecting an experimental system, researchers should consider whether their questions focus on SPCS2's structure, its interactions with other SPC components, or its function in signal sequence processing. For functional studies, mammalian cell systems or reconstituted in vitro systems are typically preferred to maintain the native context of SPCS2 activity .

How can molecular dynamics simulations be utilized to study SPCS2's effect on membrane properties?

Molecular dynamics simulations provide powerful insights into how SPCS2 influences the membrane environment surrounding the signal peptidase complex. Coarse-grained molecular dynamics (CGMD) simulations of membrane-embedded SPC models, with and without SPCS2, reveal that SPCS2 contributes to membrane thinning at the center of the complex where signal peptides are positioned prior to cleavage .

To implement this approach, researchers should:

  • Obtain structural models of the complete SPC (including SPCS2) using techniques like AlphaFold2-Multimer

  • Embed these models in membrane bilayers with appropriate lipid compositions

  • Run simulations under physiologically relevant conditions

  • Analyze membrane thickness, fluidity, and other properties in the vicinity of the complex

These simulations can help explain experimental observations regarding substrate discrimination, as the altered membrane environment likely influences how signal peptides and signal-anchored sequences are presented to the catalytic site .

What approaches can be used to study the interaction between SPCS2 and the Sec61 translocon?

The interaction between SPCS2 and the Sec61 translocon represents a key aspect of coordinated protein translocation and signal peptide processing. Several complementary approaches can be employed to study this interaction:

  • Co-immunoprecipitation assays: Using antibodies against tagged versions of SPCS2 or Sec61β to pull down associated proteins

  • Proximity labeling methods: BioID or APEX2 fused to SPCS2 to identify proximal proteins in the native cellular environment

  • Fluorescence resonance energy transfer (FRET): To visualize and quantify the interaction dynamics in living cells

  • Cross-linking mass spectrometry: To identify specific residues involved in the interaction

Interpretation of results should consider that SPCS2-Sec61 interactions are likely transient and may depend on the presence of actively translocating substrates. While SPCS2 interacts with the β subunit of the Sec61 translocon in both yeast and mammals, the signal peptides of secretory precursors are efficiently processed even in the absence of this interaction, indicating that the connection between SPCS2 and the translocon is not absolutely essential for all SPC functions .

How does the C-terminal domain of SPCS2 contribute to N-length dependent signal sequence cleavage?

The C-terminal domain of SPCS2 plays a significant role in N-length dependent signal sequence cleavage, influencing how the SPC discriminates between different types of signal sequences. Research indicates that SPCS2 promotes cleavage of signal sequences with short N-regions (N# < 16) while reducing cleavage of those with longer N-regions (N# > 16) .

To investigate this function, researchers can:

  • Generate SPCS2 constructs with C-terminal truncations or point mutations

  • Express these constructs in SPCS2-depleted cell lines

  • Assess processing of reporter proteins carrying signal sequences with varying N-region lengths

  • Perform pulse-chase experiments to capture the kinetics of signal sequence processing

A comprehensive experimental design should include testing natural secretory proteins with different N-region characteristics, such as Ecm38 and Kar2 (both with 10-residue N-regions), which show decreased cleavage efficiency in the absence of functional SPCS2 .

What are the best approaches for quantifying SPCS2's effect on signal sequence processing efficiency?

Accurately quantifying SPCS2's effect on signal sequence processing requires rigorous experimental design and data analysis. Recommended approaches include:

  • Pulse-labeling experiments: Incorporate radioactive amino acids (e.g., 35S-methionine) to label newly synthesized proteins, followed by immunoprecipitation and SDS-PAGE analysis to visualize precursor and mature forms

  • Quantitative Western blotting: Using fluorescent secondary antibodies and digital imaging systems for precise quantification of processing efficiency

  • Reporter systems: Employing dual-reporter constructs where signal sequence cleavage activates a measurable output (fluorescence or enzymatic activity)

Data should be presented in properly formatted tables showing:

Signal Sequence TypeProcessing Efficiency (WT)Processing Efficiency (ΔSPCS2)Fold Change
Short N-regionXX% ± SDXX% ± SDX.X
Long N-regionXX% ± SDXX% ± SDX.X
Signal-anchoredXX% ± SDXX% ± SDX.X

Statistical analysis should include appropriate tests for significance, and researchers should be careful to capture time-dependent effects by conducting pulse-chase experiments with multiple time points .

How should contradictory results in SPCS2 functional studies be interpreted?

Contradictory results in SPCS2 functional studies may arise from several sources, including differences in experimental systems, substrate properties, or assay conditions. When confronting such contradictions, researchers should:

  • Carefully examine experimental differences: Cell types, expression levels, assay sensitivity, and time frames can all influence outcomes

  • Consider substrate-specific effects: SPCS2 may have differential impacts on various signal sequences based on their specific properties

  • Evaluate redundancy and compensation: Other SPC components or cellular mechanisms may compensate for SPCS2 deficiency in certain contexts

  • Assess technical limitations: Some contradictions may stem from limitations in detection methods or experimental design

A systematic approach to resolving contradictions involves replicating published experiments with careful attention to methodological details, followed by direct comparison under standardized conditions. When presenting contradictory results, researchers should use comparative data tables showing methodological differences and outcomes across studies .

What controls are essential for validating SPCS2 functional assays?

Robust controls are critical for validating functional assays involving recombinant human SPCS2. Essential controls include:

  • Expression level validation: Confirming that recombinant SPCS2 is expressed at levels comparable to endogenous protein

  • Localization controls: Verifying proper membrane insertion and ER localization of SPCS2 constructs

  • Positive controls: Including well-characterized substrates known to be dependent on SPCS2 for efficient processing

  • Negative controls: Testing signal sequences known to be processed independently of SPCS2

  • Rescue experiments: Demonstrating that observed defects in SPCS2-depleted systems can be reversed by reintroduction of wild-type SPCS2

  • Catalytic subunit controls: Confirming that the catalytic subunit (Sec11) remains functional in SPCS2 manipulation experiments

Additionally, researchers should conduct time course experiments to distinguish between effects on processing efficiency versus processing kinetics, as SPCS2 may influence the rate rather than the absolute capacity for signal sequence cleavage .

How can CRISPR-Cas9 genome editing be utilized to study SPCS2 function in human cells?

CRISPR-Cas9 genome editing offers powerful approaches for studying SPCS2 function in human cells through precise genetic manipulation. Key strategies include:

  • Complete knockout: Generating SPCS2-null cell lines to assess its necessity for cell viability and global protein secretion

  • Conditional knockout: Creating inducible SPCS2 depletion systems to study acute versus chronic effects

  • Endogenous tagging: Introducing epitope or fluorescent tags at the SPCS2 locus for visualization and purification of native complexes

  • Domain-specific mutations: Engineering precise mutations to disrupt specific functions while preserving others

  • Humanized model systems: Replacing yeast Spc2 with human SPCS2 to study species-specific functions

When designing CRISPR experiments, researchers should consider potential off-target effects and the possibility of compensation by related pathways. Validation of edited cell lines should include sequencing confirmation, protein expression analysis, and functional assessment of the signal peptidase complex .

What are the implications of SPCS2 dysfunction for human disease research?

SPCS2 dysfunction has potential implications for various human diseases related to protein secretion and trafficking. Research directions in this area should consider:

  • Neurodegenerative disorders: Many neurodegenerative diseases involve secretory pathway dysfunction and protein misfolding

  • Immune system disorders: Given the importance of secreted proteins in immune function, SPCS2 defects might compromise immunity

  • Developmental disorders: Proper protein trafficking is essential during development, and SPCS2 mutations could disrupt critical signaling pathways

  • Cancer biology: Altered protein secretion profiles in cancer cells might involve changes in signal peptide processing efficiency

Research approaches should include gene association studies in patient populations, functional characterization of disease-associated variants, and development of cellular and animal models expressing disease-relevant SPCS2 mutations. The potential role of SPCS2 as a therapeutic target should also be explored, particularly for conditions involving aberrant protein secretion .

How can structural biology approaches advance our understanding of SPCS2 function?

Structural biology approaches offer significant potential for advancing our understanding of SPCS2 function within the signal peptidase complex. Promising methodologies include:

  • Cryo-electron microscopy (cryo-EM): To determine the structure of the intact SPC with SPCS2 in native membrane environments

  • X-ray crystallography: For high-resolution structures of specific SPCS2 domains or subcomplexes

  • NMR spectroscopy: To characterize dynamic regions and interaction interfaces

  • Integrative structural biology: Combining computational modeling with experimental constraints from crosslinking mass spectrometry, FRET, and other techniques

  • Molecular dynamics simulations: To understand how SPCS2 influences membrane properties and substrate presentation

Recent advances in AlphaFold2-Multimer modeling provide valuable starting points for these studies, as demonstrated by simulations showing that membrane thinning at the center of SPC is reduced without SPCS2 . These structural insights can guide the design of targeted functional studies to elucidate precisely how SPCS2 modulates substrate recognition and cleavage site selection.

What are the optimal expression systems for producing functional recombinant human SPCS2?

Selecting the appropriate expression system is crucial for obtaining functional recombinant human SPCS2 for research purposes. Key considerations include:

  • Mammalian expression systems: HEK293 or CHO cells provide the most native environment for SPCS2 expression, including proper post-translational modifications and membrane insertion. These systems are ideal for functional studies but may yield lower protein amounts.

  • Insect cell systems: Baculovirus-infected Sf9 or High Five cells offer a compromise between native-like processing and higher protein yields, particularly useful for structural studies requiring larger amounts of protein.

  • Cell-free systems: Wheat germ or rabbit reticulocyte lysate supplemented with microsomes can be used for rapid expression and functional assessment of SPCS2 variants.

  • Bacterial systems: While E. coli can express specific soluble domains of SPCS2, this system is generally not suitable for full-length SPCS2 due to its membrane protein nature and requirements for eukaryotic-specific modifications.

For optimal results, researchers should use mammalian or insect cell systems with careful attention to expression constructs that include proper signal sequences, transmembrane domains, and minimal epitope tags that don't interfere with function .

What purification strategies yield the highest purity and activity for recombinant SPCS2?

Purifying membrane proteins like SPCS2 while maintaining their functional integrity presents significant challenges. Effective purification strategies include:

  • Detergent selection: Testing multiple detergents (DDM, LMNG, GDN) to identify those that maintain SPCS2 stability and association with other SPC components

  • Affinity purification: Using well-positioned tags (e.g., C-terminal His6 or Twin-Strep tags) for initial capture, with careful validation that tags don't interfere with function

  • Size exclusion chromatography: To separate intact SPC complexes from individual components or aggregates

  • Lipid nanodisc reconstitution: Transferring purified SPCS2 (alone or with SPC partners) into nanodiscs for functional and structural studies in a more native lipid environment

Quality control for purified SPCS2 should include assessment of:

  • Purity by SDS-PAGE and mass spectrometry

  • Structural integrity using circular dichroism or limited proteolysis

  • Functional activity in reconstituted systems with model substrates

  • Association with other SPC components by co-immunoprecipitation or native gel electrophoresis

Researchers should report detailed purification tables showing yields, purity, and specific activity at each purification step .

How can researchers effectively design and interpret SPCS2 mutagenesis experiments?

Mutagenesis experiments are valuable for dissecting SPCS2's structure-function relationships, but require careful design and interpretation. Best practices include:

  • Rational design based on:

    • Evolutionary conservation analysis (comparing SPCS2 sequences across species)

    • Structural predictions or experimental structures

    • Known functional domains, particularly the C-terminal domain involved in N-length dependent signal sequence cleavage

    • Disease-associated variants

  • Comprehensive mutation strategies:

    • Alanine-scanning mutagenesis of conserved regions

    • Domain swapping between homologs from different species

    • Truncation series to map domain boundaries

    • Charge-reversal mutations for surface residues involved in interactions

  • Appropriate functional readouts:

    • Signal sequence processing efficiency for different substrate classes

    • Interaction with other SPC components and the Sec61 translocon

    • Membrane integration and localization

    • Effects on membrane properties around the SPC

When interpreting results, researchers should distinguish between mutations affecting SPCS2 stability, its integration into the SPC, and those specifically disrupting substrate processing or discrimination functions. Combining mutagenesis with structural studies and molecular dynamics simulations can provide deeper insights into the mechanistic basis of SPCS2 function .

What are the most promising future research directions for SPCS2 studies?

Research on recombinant human SPCS2 continues to evolve, with several promising directions for future investigation:

  • High-resolution structural studies of the complete human SPC, including SPCS2, in different functional states and with bound substrates

  • Comprehensive characterization of the SPCS2 interactome beyond the core SPC components and Sec61 translocon

  • Investigation of potential regulatory mechanisms controlling SPCS2 function, including post-translational modifications and protein-protein interactions

  • Development of small molecule modulators of SPCS2 activity as research tools and potential therapeutic leads

  • Systems biology approaches to understand how SPCS2 contributes to global proteostasis and secretory pathway function

Advances in cryo-electron microscopy, improved membrane protein expression systems, and computational biology tools are likely to accelerate progress in these areas. Integrating knowledge across multiple model systems, from yeast to human cells, will be crucial for building a comprehensive understanding of SPCS2 biology .

How might advances in SPCS2 research impact broader understanding of protein trafficking disorders?

Advances in SPCS2 research have significant implications for understanding and potentially treating protein trafficking disorders:

  • Mechanistic insights: Understanding how SPCS2 modulates substrate- and cleavage site-selection provides fundamental knowledge about signal sequence processing, a critical step in protein trafficking

  • Biomarker development: Altered signal peptide processing patterns could serve as diagnostic or prognostic markers for secretory pathway dysfunctions

  • Therapeutic targeting: Modulating SPCS2 function could potentially rescue specific trafficking defects by altering the stringency of signal sequence discrimination

  • Protein production applications: Engineered SPCS2 variants might enhance the production of difficult-to-express recombinant proteins in biotechnology applications

As research progresses, a systems-level understanding of how SPCS2 contributes to secretory pathway homeostasis will likely emerge, connecting this relatively understudied component to broader mechanisms of protein quality control and trafficking. This knowledge will be invaluable for addressing the growing number of human diseases linked to protein trafficking defects .

What methodological advances are needed to overcome current limitations in SPCS2 research?

Several methodological challenges currently limit SPCS2 research, and addressing these would significantly advance the field:

  • Improved membrane protein structural techniques: Better methods for determining structures of membrane protein complexes like the SPC in their native lipid environments

  • Real-time assays: Development of approaches to monitor signal sequence processing in real-time within living cells

  • Single-molecule techniques: Methods to observe individual SPCS2-containing complexes and their interactions with substrates

  • Tissue-specific analyses: Tools to study SPCS2 function in different cell types and tissues, where substrate profiles and requirements may differ

  • Quantitative proteomics: More sensitive approaches to comprehensively identify proteins affected by SPCS2 dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.