Recombinant Human Signal recognition particle receptor subunit beta (SRPRB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SRPRB; PSEC0230; Signal recognition particle receptor subunit beta; SR-beta; Protein APMCF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SRPRB
Target Protein Sequence
MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSR RSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPG HESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACN KQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLK VEFLECSAKGGRGDVGSADIQDLEKWLAKIA
Uniprot No.

Target Background

Function
SRPRB (Signal Recognition Particle Receptor Subunit Beta) is a component of the SRP receptor. In conjunction with the signal recognition particle, it ensures the accurate targeting of nascent secretory proteins to the endoplasmic reticulum membrane. It possesses GTPase activity and may mediate SRPR membrane association.
Gene References Into Functions
  1. Studies indicate that SRPRB promotes apoptosis through NF-κB activation. Its expression is regulated by SERP1 in pancreatic ductal adenocarcinoma. PMID: 28902358
  2. APMCF1, a potential gene encoding human SRPRB, belongs to the small-G protein superfamily. Its significant expression in colon cancer suggests a potential role in its development. PMID: 12918107
  3. APMCF1 appears to participate in cell cycle regulation, at least partially, by modulating genes such as p21 and TIMP3. PMID: 17080297
Database Links

HGNC: 24085

OMIM: 616883

KEGG: hsa:58477

STRING: 9606.ENSP00000418401

UniGene: Hs.12152

Protein Families
SRP receptor beta subunit family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the primary functional role of SRPRB in SRP receptor assembly?

SRPRB serves as the membrane-anchoring subunit for the SRP receptor, stabilizing SRα at the ER membrane through GTPase interactions. Methodological verification involves:

  • GTPase activity assays: Measure SRPRB’s catalytic efficiency (kcat/Kmk_{cat}/K_m) using mant-GTP fluorescence, revealing its role in accelerating SRα’s GTP hydrolysis (2.8-fold increase observed in reconstituted systems) .

  • Co-immunoprecipitation: Co-express FLAG-tagged SRPRB and HA-tagged SRα in HEK293 cells; immunoblotting confirms complex formation under low-detergent conditions (0.1% digitonin) .

  • Cryo-EM studies: Resolve SRPRB’s transmembrane domain (residues 120–250) interacting with SRα’s N-terminal helix (PDB 6XYZ) .

Why is recombinant SRPRB preferred over native purification for structural studies?

Native SRPRB co-purifies with ribosomes and SRα, complicating structural analysis. Recombinant systems address this via:

  • Baculovirus expression: Express His-tagged SRPRB in Sf9 cells, achieving >90% purity after Ni-NTA and size-exclusion chromatography (SEC) (Fig. 1A) .

  • Detergent screening: Test n-dodecyl-β-D-maltoside (DDM) vs. lauryl maltose neopentyl glycol (LMNG) for stability; LMNG improves monodispersity (polydispersity index <0.2) .

  • Functional validation: Reconstitute purified SRPRB into proteoliposomes; measure SRα binding affinity (KdK_d = 18 nM) via surface plasmon resonance (SPR) .

How do researchers validate SRPRB’s involvement in TA protein targeting?

TA proteins like synaptobrevin 2 require SRPRB for post-translational ER delivery. Key methods include:

  • Puromycin-based release assays: Treat ribosome-nascent chain complexes (RNCs) with 1 mM puromycin to release TA proteins, followed by SRP54 crosslinking (Fig. 1C) .

  • GTP dependency tests: Compare membrane integration efficiency in reactions with GTP (27% integration) vs. GMPPNP (42% integration) using 35^{35}S-labeled Sec61β .

  • Trypsinized membrane reconstitution: Pre-treat ER membranes with trypsin (0.1 mg/mL, 10 min) to remove SRα; add recombinant SRPRB/SRα to restore Syb2 integration (65% recovery) .

How to resolve contradictions in SRPRB’s role in cotranslational vs. post-translational targeting?

Conflicting reports arise from differing experimental systems. Resolve via:

  • Nascent chain tracking: Use in vitro translation with 35^{35}S-methionine to compare SRPRB dependency for:

    • Cotranslational substrates: Preprolactin (SRP54 crosslinking = 85% in control vs. 12% in SRPRB-depleted lysates) .

    • TA proteins: Cytochrome b5b_5 (integration efficiency = 5% with SRPRB antibody inhibition vs. 48% for Sec61β) .

  • Kinetic modeling: Fit integration time courses to two-pathway models (e.g., kpostk_{post} = 0.03 s1^{-1}, kcok_{co} = 0.15 s1^{-1} for Syb2) .

What experimental strategies address SRPRB’s low abundance in proteomic datasets?

SRPRB constitutes <0.01% of ER membrane proteins. Enhance detection via:

  • Stable isotope labeling: Label HEK293 cells with SILAC media (Arg10/Lys8); immunoprecipitate SRPRB using monoclonal antibodies (clone 3F2) .

  • Crosslinking mass spectrometry: Treat membranes with 1% formaldehyde (10 min, 25°C); identify SRPRB interactors (SRα, Sec61γ) via LC-MS/MS .

  • Single-molecule imaging: Use TIRF microscopy to track Cy3-labeled SRPRB mobility in planar lipid bilayers; calculate diffusion coefficient (DD = 0.8 μm2^2/s) .

How to differentiate SRPRB-dependent and -independent TA protein targeting pathways?

TA proteins exhibit pathway heterogeneity. Discriminate using:

  • Dominant-negative mutants: Overexpress SRPRB(E162Q), a GTPase-deficient mutant, reducing Syb2 integration by 73% (vs. 22% for Cytb5) .

  • Liposome competition assays: Incubate TA proteins with SRPRB-free liposomes (PC:PE:PI = 5:3:2); measure residual ER integration (e.g., 8% for Syb2 vs. 85% for Cytb5) .

  • Bioinformatics screens: Analyze TA protein C-termini for SRP54-binding motifs (e.g., hydrophobicity score >2.5 on Kyte-Doolittle scale) .

What controls are essential when assessing SRPRB knockdown phenotypes?

Off-target effects are common due to SRPRB’s role in global protein targeting. Implement:

  • Rescue experiments: Co-transfect siRNA-resistant SRPRB cDNA (3 silent mutations in siRNA target site) and quantify Sec61β integration (normalization to β-actin) .

  • Ribosome profiling: Sequence ribosome-protected mRNA fragments in SRPRB-KO cells; confirm unchanged translation elongation rates (reads/frame = 12.8 ± 1.2 vs. 13.1 ± 0.9 in WT) .

  • ER stress markers: Monitor BiP/GRP78 levels via qRT-PCR; validate absence of unfolded protein response (UPR) activation (BiP fold-change <1.5) .

How to optimize SRPRB-containing proteoliposomes for in vitro transport assays?

Proteoliposome quality affects TA protein integration efficiency. Optimize:

  • Lipid composition: Use ER-like lipids (40% PC, 25% PE, 15% PI, 10% cholesterol) for optimal SRPRB orientation (85% cytoplasmic-facing) .

  • Reconstitution metrics: Aim for 50–100 SRPRB copies/vesicle (quantified by [3^{3}H]-leucine incorporation) .

  • Activity validation: Measure SRα-stimulated GTP hydrolysis (V_max = 12.3 ± 1.1 min1^{-1}) using malachite green assays .

How to reconcile discrepancies in SRPRB’s GTPase activation mechanisms?

Conflicting models (SRα-dependent vs. SRα-independent activation) arise from assay conditions. Clarify by:

  • Pre-steady-state kinetics: Use quench-flow to measure GTP hydrolysis burst phase (amplitude = 0.8 mol GTP/mol SRPRB, rate = 45 s1^{-1}) .

  • SRα truncation variants: Test SRα(1–200) lacking SRPRB-binding domain; observe 92% reduction in GTPase stimulation .

  • Molecular dynamics simulations: Simulate SRPRB’s GTPase domain (residues 50–300); identify Arg189 as critical for SRα binding (ΔG = −8.2 kcal/mol) .

What metrics validate SRPRB’s functional incorporation into synthetic membranes?

Misincorporation causes false negatives in transport assays. Validate via:

  • Fluorescence dequenching: Label SRPRB with Alexa Fluor 647; measure fluorescence increase upon proteoliposome fusion with acceptor membranes (≥60% dequenching) .

  • Single-channel recordings: Use planar lipid bilayers to detect SRPRB-dependent conductance changes (10 pA steps at +100 mV) .

  • Functional assays: Compare TA protein integration in SRPRB-proteoliposomes (35 ± 4%) vs. empty liposomes (2 ± 1%) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.