Recombinant Human Small integral membrane protein 4 (SMIM4)-VLPs

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance, as additional fees for dry ice and a dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time.
Note: Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C and ensure to avoid repeated freezing and thawing. This will help maintain optimal protein activity.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you require a specific tag type, please inform us, and we will assess the feasibility of development.
Synonyms
SMIM4; C3orf78; Small integral membrane protein 4
Datasheet & Coa
Please contact us to get it.
Expression Region
1-70aa
Research Area
Others
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
SMIM4
Target Protein Sequence
MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Database Links

HGNC: 37257

KEGG: hsa:440957

UniGene: Hs.660577

Protein Families
SMIM4 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are SMIM4-VLPs and how do they differ from conventional VLPs?

SMIM4-VLPs are virus-like particles that incorporate the human Small Integral Membrane Protein 4 into their structure. Unlike conventional VLPs that typically consist only of viral structural proteins, SMIM4-VLPs integrate this transmembrane protein to create nanostructures with specific biological properties.

VLPs are non-infectious nanostructures that spontaneously assemble from viral structural proteins, forming particles that mimic the morphology of native viruses but lack genetic material . SMIM4-VLPs represent an adaptation of this technology where the Small Integral Membrane Protein 4, a human transmembrane protein, is incorporated into the VLP structure through recombinant technology.

The integration of SMIM4 into VLPs creates a platform that combines the immunogenic properties of VLPs with the specific biological functions of SMIM4, potentially offering unique applications in research and therapeutics.

What expression systems are most suitable for producing SMIM4-VLPs?

The production of SMIM4-VLPs can be achieved through several expression systems, each with distinct advantages depending on research objectives:

  • Mammalian cell systems (HEK293): Provide proper post-translational modifications and are particularly suitable for producing SMIM4-VLPs that require authentic human protein modifications . These systems allow for the secretion of high-quality VLPs with properly folded transmembrane proteins.

  • Insect cell systems: Offer high yield production of VLPs and can accommodate the expression of transmembrane proteins with reasonable post-translational modifications . They represent a good balance between yield and protein quality.

  • Plant-based expression systems: While they have lower production levels compared to mammalian systems, recent advancements in plant glycoengineering have improved their capacity to produce human-like proteins . They offer advantages in terms of cost-effectiveness and scalability.

  • E. coli systems: Suitable for producing non-glycosylated SMIM4 protein components that can be later assembled into VLPs in vitro .

The selection of an expression system should be based on specific research requirements, with mammalian cell systems generally preferred when authentic human protein conformation is critical.

What methods are effective for characterizing the structural integrity of SMIM4-VLPs?

Structural characterization of SMIM4-VLPs requires a multi-method approach:

Microscopy Techniques:

  • Negative stain Transmission Electron Microscopy (TEM): Provides initial assessment of VLP morphology and size distribution .

  • Cryo-Electron Microscopy (Cryo-EM): Offers higher resolution analysis of VLP structure (3.0-3.5 Å resolution) and can reveal detailed protein arrangements .

  • Atomic Force Microscopy (AFM): Allows analysis of VLP elasticity and physical properties, which can be analyzed using methods such as Gaussian Mixture Models to identify different structural states .

Biochemical and Biophysical Methods:

  • Sucrose density gradient: Evaluates VLP homogeneity and can be used to assess binding of target molecules .

  • Dynamic Light Scattering (DLS): Measures size distribution and aggregation state.

  • ELISA assays: Confirm the presence and accessibility of SMIM4 epitopes on the VLP surface .

Data Analysis Approaches:

  • Symmetric and asymmetric reconstructions from cryo-EM data

  • Focused classification techniques for resolving low-occupancy features

  • Statistical distribution analysis using Gaussian mixture models to identify VLP subpopulations

Characterization MethodInformation ProvidedResolution/SensitivitySample Requirements
Negative stain TEMMorphology, size10-20 nmPurified VLPs (5-10 μg/mL)
Cryo-EMHigh-resolution structure3.0-3.5 ÅHighly purified VLPs (0.5-1 mg/mL)
AFMElasticity, physical propertiesNanometer scaleSurface-immobilized VLPs
Sucrose density gradientHomogeneity, complex formationN/A50-100 μg purified VLPs
ELISAEpitope accessibilityng/mL rangeVLPs with exposed epitopes

How can the immunogenicity of SMIM4-VLPs be optimized for potential therapeutic applications?

Optimizing SMIM4-VLP immunogenicity involves strategic modifications to both structure and administration protocols:

Structural Optimization:

  • Strategic epitope placement: The selection of insertion sites significantly affects immunogenicity. Studies with other VLPs have shown that insertion into structural loops (especially loops 1 and 2 in the case of NoV VLPs) results in superior antibody production against conformational epitopes compared to loop 3 . For SMIM4-VLPs, this suggests careful mapping of potential insertion sites for optimal epitope display.

  • Linker optimization: Using flexible (GGS)4 linkers between SMIM4 and the VLP scaffold can improve proper protein folding and epitope accessibility . The linker design must balance flexibility with structural stability.

  • Multimerization strategy: Presenting SMIM4 proteins in a densely repetitive pattern (5-10nm spacing) enhances B-cell receptor clustering and activation, significantly improving antibody responses compared to monomeric antigen presentation .

Administration Protocols:

  • Heterologous prime-boost strategies: Combining SMIM4-VLPs with other vaccine platforms (like mRNA) in prime-boost regimens induces higher antibody titers and improved avidity compared to homologous regimens. Data from similar approaches showed that VLP boosts following mRNA primes resulted in stable antibody titers for at least 5 months post-vaccination .

  • Adjuvant selection: While VLPs themselves have adjuvant-like properties due to their particulate nature and PAMP-like characteristics, strategic adjuvant selection can further enhance specific immune responses. Squalene-based oil-in-water nanoemulsions have shown efficacy with VLP platforms .

Immune Response Evaluation:

  • Monitor both antibody titers and avidity, as VLP-based vaccines typically induce high-avidity antibodies after multiple immunizations .

  • Assess both humoral and cellular immune responses, as VLPs activate both arms of adaptive immunity through efficient cross-presentation on MHC class I and II pathways .

What are the key challenges in ensuring stability of SMIM4-VLPs during purification and storage?

SMIM4-VLPs face several stability challenges as transmembrane protein-containing particles:

Purification Challenges:

  • Aggregation during concentration: Transmembrane proteins within VLPs increase hydrophobic interactions, leading to particle aggregation during concentration steps. This can be mitigated using "on-grid binding" approaches for analytical samples or gentle concentration methods such as tangential flow filtration with optimized membrane materials.

  • Structural heterogeneity: SMIM4-VLPs may assemble into particles with different triangulation numbers (T=3 and T=4 configurations observed in similar VLPs) . This heterogeneity complicates purification and characterization, requiring methods like focused classification of cryo-EM data to resolve distinct particle populations.

  • Occupancy variation: Incorporation of transmembrane proteins like SMIM4 may occur with variable efficiency, resulting in particles with different protein densities. Evidence from similar systems shows that Affimer-modified VLPs display target proteins at low occupancy in cryo-EM reconstructions despite high occupancy detected in solution-based assays .

Storage Stability Solutions:

  • Buffer optimization: For liquid formulations, Tris/PBS-based buffers with 5-50% glycerol have shown efficacy for similar recombinant proteins . The optimal glycerol concentration balances stabilization against increased viscosity.

  • Lyophilization strategies: For long-term storage, lyophilization with 6% trehalose (pH 8.0) provides superior stability . Lyophilized preparations have demonstrated shelf-life up to 12 months at -20°C/−80°C compared to 6 months for liquid formulations.

  • Temperature sensitivity: Temperature and pH significantly affect the stability of VLP disulfide linkages and self-assembly properties . Maintaining strict temperature control during handling prevents thermal denaturation and structural changes that can be detected using nano-indentation techniques.

Monitoring Strategies:

  • Regular assessment of particle integrity using negative-stain TEM

  • Periodic functional testing via binding assays to verify accessible epitopes

  • Staggered stability testing at different time points and storage conditions

How can SMIM4-VLPs be modified to optimize targeting to specific tissue types?

Engineering SMIM4-VLPs for tissue-specific targeting requires strategic modifications:

Surface Modification Strategies:

  • Genetic fusion approach: SMIM4 can be fused with tissue-targeting domains via flexible linkers positioned at the N-terminus, similar to the N-VelcroVax system which successfully presented targeting Affimers . This approach ensures the targeting domain is well-exposed on the VLP surface.

  • Insertion site optimization: Strategic insertion of targeting moieties into specific loops of the VLP scaffold rather than terminal fusion can improve targeting efficiency. Studies with NoV VLPs demonstrated that loops 1 and 2 provide superior conformational presentation compared to loop 3 .

  • Chemical conjugation: For complex targeting moieties that may disrupt VLP assembly when genetically fused, post-assembly chemical conjugation using click chemistry or maleimide coupling to surface-exposed residues offers an alternative approach .

Targeting Domain Selection:

  • Cell-specific antibody fragments (scFvs)

  • Receptor-binding domains from viruses with known tropism

  • Tissue-specific peptides identified through phage display

  • Aptamers selected for tissue-specific binding

Validation Methods:

  • In vitro binding assays: Comparing binding affinity to target vs. non-target cells using flow cytometry and confocal microscopy

  • Ex vivo tissue section binding: Evaluating VLP distribution on tissue slices

  • In vivo biodistribution studies: Tracking fluorescently-labeled VLPs to confirm targeted delivery

Optimization Considerations:

  • Balance between targeting efficiency and VLP stability

  • Potential impact of targeting domains on immunogenicity

  • Effect of targeting moieties on cellular uptake mechanisms

What are the most effective methods for monitoring batch-to-batch consistency in SMIM4-VLP production?

Ensuring batch-to-batch consistency of SMIM4-VLPs requires comprehensive analytical methods:

Physical Characterization:

  • Size distribution analysis: Dynamic Light Scattering (DLS) and Nanoparticle Tracking Analysis (NTA) provide quantitative assessment of particle size distribution and concentration.

  • Morphological examination: Negative-stain TEM offers visual confirmation of consistent VLP formation and architecture across batches .

  • Thermostability profiling: Differential Scanning Calorimetry (DSC) measures the thermal denaturation profile to confirm consistent folding and stability.

Biochemical Analysis:

  • Protein composition verification: SDS-PAGE and Western blotting confirm the presence of SMIM4 and VLP scaffold proteins in the expected ratios.

  • Mass spectrometry: Peptide mapping ensures consistent primary structure and post-translational modifications between batches.

  • Functional binding assays: ELISA or surface plasmon resonance (SPR) assays verify consistent binding properties to target molecules .

Advanced Structural Assessment:

  • Cryo-EM analysis: Low-resolution structural comparison between batches can identify significant conformational differences .

  • Asymmetric reconstruction: This technique can reveal variations in SMIM4 presentation on the VLP surface that might not be apparent in symmetric reconstructions .

  • Focused classification: This approach can identify heterogeneity in particle populations that might vary between batches .

Critical Quality Attributes (CQAs) and Acceptance Criteria:

Quality AttributeMethodAcceptance Criteria
Particle sizeDLSMean diameter 25-100 nm with PDI < 0.3
MorphologyNegative-stain TEM>80% particles with expected morphology
SMIM4 contentWestern blotSMIM4:scaffold protein ratio within ±15% of reference standard
Functional bindingELISAEC50 within ±20% of reference standard
Protein puritySDS-PAGE>85% purity of assembled VLPs
Endotoxin contentLAL assay<10 EU/mg protein
Host cell proteinELISA<100 ng/mg VLP protein
Host cell DNAqPCR<10 ng/mg VLP protein

What controls are essential when assessing SMIM4-VLP binding to target molecules?

Robust experimental design for SMIM4-VLP binding studies requires comprehensive controls:

Essential Negative Controls:

  • Empty VLPs: VLPs lacking SMIM4 but otherwise identical to test particles control for non-specific binding interactions mediated by the VLP scaffold .

  • Non-target protein binding: Testing binding to irrelevant proteins of similar size/charge to rule out non-specific interactions.

  • Blocking controls: Pre-incubation with free SMIM4 protein should competitively inhibit specific binding if the interaction is SMIM4-mediated.

  • No primary antibody: For immunodetection methods, samples processed without primary antibody control for non-specific secondary antibody binding .

Critical Positive Controls:

  • Known SMIM4 ligands: Verified binding partners serve as positive controls to confirm functional SMIM4 presentation.

  • Anti-SMIM4 antibodies: Monoclonal antibodies against SMIM4 confirm accessibility of the protein on the VLP surface .

  • Tagged VLPs: VLPs with well-characterized epitope tags (His, c-Myc) provide system validation controls .

Technical Controls:

  • On-grid binding approach: For electron microscopy studies, this method prevents particle aggregation while allowing assessment of binding interactions .

  • Signal calibration standards: Known quantities of reference proteins establish quantitative binding curves.

  • Buffer-only controls: Account for background signal in all detection systems.

Advanced Analytical Controls:

  • Sucrose density gradient fractionation: Controls for VLP heterogeneity and confirms true binding versus co-purification artifacts .

  • Size exclusion chromatography: Verifies complex formation through shifts in elution profiles.

  • Analytical ultracentrifugation: Provides solution-based evidence of stable complex formation.

How should experiments be designed to evaluate the immunogenicity of SMIM4-VLPs in animal models?

Designing animal immunogenicity studies for SMIM4-VLPs requires careful planning:

Study Design Parameters:

  • Animal model selection: BALB/c mice are commonly used for initial immunogenicity studies of VLP-based vaccines . For more translational data, humanized mouse models or larger animals may be appropriate depending on the research question.

  • Group sizing: Minimum n=5-10 per experimental group to ensure statistical power .

  • Immunization schedule: A three-dose regimen (days 0, 14, 28) with sample collection 14 days after the final dose allows assessment of prime-boost effects .

  • Route of administration: Subcutaneous injection is most common, though intranasal or oral routes may be appropriate for mucosal immunity studies .

  • Adjuvant selection: Squalene-based oil-in-water nanoemulsions (e.g., AddaVax) are effective with VLP platforms, though comparing adjuvanted and non-adjuvanted formulations may reveal the intrinsic immunostimulatory properties of the VLPs .

Control Groups:

  • Empty VLP platform: Controls for immune responses directed against the VLP scaffold rather than SMIM4 .

  • Recombinant soluble SMIM4: Controls for effects of particulate presentation versus soluble antigen.

  • PBS/adjuvant only: Negative control for background immune responses.

  • Heterologous platform comparison: When available, comparison to SMIM4 delivered via alternative platforms (e.g., mRNA) .

Immune Response Analysis:

  • Antibody response: ELISA measurement of SMIM4-specific IgG titers in serum, with additional analysis of IgG subclasses to characterize Th1/Th2 balance .

  • Antibody avidity: Include avidity measurements using chaotropic agents to assess antibody maturation following multiple immunizations .

  • Functional assays: Depending on SMIM4 function, include relevant functional assays to assess neutralizing or blocking capacity of induced antibodies.

  • Cellular immunity: ELISpot or flow cytometry-based intracellular cytokine staining to assess T-cell responses to SMIM4 epitopes .

  • Long-term immunity: Extended follow-up (3-6 months) to assess antibody persistence and memory responses .

Data Analysis Approach:

What methods can be used to quantitatively assess the density and orientation of SMIM4 proteins on the VLP surface?

Quantitative assessment of SMIM4 display on VLPs requires multiple complementary approaches:

Biochemical Quantification:

  • Western blotting with densitometry: Comparing band intensities of SMIM4 to known quantities of VLP scaffold proteins allows estimation of the SMIM4:VLP ratio .

  • ELISA-based quantification: Using calibrated standards of recombinant SMIM4 protein to establish a standard curve for quantifying SMIM4 on intact VLPs .

  • Mass spectrometry-based quantification: Absolute quantification using isotopically labeled reference peptides provides precise molecular ratios.

Structural Visualization:

  • Immunogold labeling: Gold nanoparticles conjugated to anti-SMIM4 antibodies allow visualization and counting of SMIM4 molecules on VLP surfaces by electron microscopy .

  • Cryo-EM density analysis: Symmetric and asymmetric reconstructions can reveal the presence and orientation of SMIM4 proteins, though low occupancy may require focused classification approaches .

  • Super-resolution fluorescence microscopy: Using fluorescently labeled antibodies against SMIM4 can provide quantitative data on protein density per particle.

Biophysical Approaches:

Data Integration Framework:
From studies with similar VLP systems, we can establish quantitative benchmarks:

MethodInformation ProvidedDetection LimitKey Limitations
Immunogold + TEMDirect visualization of SMIM4 distribution~1 protein per 10 nm²Sample preparation artifacts
Cryo-EM with focused classificationStructural confirmation of SMIM4 orientationDetects low occupancy (~10-20%)Requires high-end equipment
ELISA quantificationTotal SMIM4 content~0.1-1 ng/mLCannot distinguish surface vs. internal proteins
SPR binding analysisFunctional SMIM4 accessibilityDepends on ligand affinityRequires known SMIM4 binding partner

How can researchers address low expression yields of SMIM4-VLPs in recombinant systems?

Troubleshooting low SMIM4-VLP yields requires systematic optimization:

Expression System Optimization:

  • Codon optimization: Adapting the SMIM4 coding sequence to the expression host's codon usage can significantly improve translation efficiency. For mammalian cell expression, human codon optimization typically increases yields by 2-5 fold .

  • Expression vector selection: Using vectors with strong promoters appropriate for the expression system (e.g., CMV for mammalian cells, polyhedrin for baculovirus systems) maximizes transcription .

  • Signal sequence optimization: For secreted VLPs, optimizing the signal peptide to match the host cell's secretory pathway improves export efficiency. The native SMIM4 signal sequence may not be optimal in heterologous systems .

Protein Engineering Approaches:

  • Fusion partner selection: Adding stabilizing domains (e.g., SUMO tag) can improve folding and prevent premature degradation of the fusion protein .

  • Linker optimization: Flexible linkers (GGS)4 between SMIM4 and the VLP scaffold protein prevent steric hindrance and improve assembly .

  • Mutation of problematic residues: Introducing stabilizing mutations (e.g., E50Q and D77N in TMV coat protein) can enhance VLP assembly efficiency .

Culture Condition Adjustments:

  • Temperature reduction: Lower culture temperatures (28-30°C for mammalian cells, 25-27°C for insect cells) slow protein synthesis, allowing more time for proper folding of complex transmembrane proteins .

  • Media supplementation: Adding chemical chaperones (e.g., 4-phenylbutyric acid) or specific lipids can improve membrane protein folding and VLP assembly.

  • Induction optimization: For inducible systems, determining optimal induction timing and inducer concentration prevents cellular stress responses that reduce yield.

Purification Strategy Refinements:

  • Gentle extraction methods: Using mild detergents and avoiding harsh sonication preserves VLP structure during initial extraction .

  • Density gradient optimization: Adjusting sucrose gradient concentrations improves separation of fully-assembled VLPs from aggregates and assembly intermediates .

  • Stabilizing additives: Including glycerol (5-50%) in purification buffers maintains VLP stability throughout the process .

Case-Specific Yield Improvements:
From similar systems, specific interventions have demonstrated significant yield improvements:

InterventionTypical Yield ImprovementImplementation Complexity
Codon optimization2-5×Low (one-time DNA synthesis)
Temperature reduction1.5-3×Low (simple protocol adjustment)
Signal sequence optimization2-4×Medium (requires testing multiple sequences)
Media supplementation1.5-2×Low (simple reagent addition)
Fusion partner addition2-8×High (requires extensive construct redesign)

What approaches can resolve issues with heterogeneous VLP assembly or aggregation?

Addressing VLP heterogeneity and aggregation requires targeted interventions:

Diagnosing the Problem:

  • Size distribution analysis: DLS or NTA provides quantitative assessment of particle populations, revealing whether the issue is primarily heterogeneity (multiple discrete populations) or aggregation (progressive increase in size).

  • Negative-stain TEM: Visual examination distinguishes between true VLP assembly heterogeneity (particles of different sizes but correct morphology) versus misfolding/aggregation (amorphous structures) .

  • Analytical ultracentrifugation: Sedimentation velocity experiments can resolve and quantify distinct particle populations based on size and shape.

Addressing VLP Size Heterogeneity:

  • Scaffold protein engineering: Strategic mutations in the VLP scaffold protein can bias assembly toward a preferred triangulation number. Similar approaches with hepatitis B core protein have successfully favored T=3 or T=4 assemblies .

  • Assembly condition optimization: Controlling pH, ionic strength, and protein concentration during assembly can shift the equilibrium toward more homogeneous populations. For many VLPs, assembly at pH 7.2-7.4 with 150mM NaCl produces more uniform particles .

  • Post-assembly purification: Size exclusion chromatography or rate-zonal centrifugation can separate different VLP size populations for applications requiring homogeneous particles .

Preventing Aggregation:

  • On-grid binding approach: For analytical studies, this method prevents particle aggregation while allowing assessment of binding interactions by applying purified components directly to EM grids .

  • Stabilizing excipients: Adding non-ionic detergents (0.01% Tween-20) or carrier proteins (0.1% BSA) reduces hydrophobic interactions that drive aggregation.

  • Optimized buffer systems: Tris/PBS-based buffers with 5-50% glycerol have shown efficacy for similar recombinant proteins . For long-term storage, addition of 6% trehalose improves stability .

  • Surface charge modifications: Introducing charged residues on the VLP surface can increase electrostatic repulsion between particles, reducing aggregation tendency.

Resolving Existing Aggregates:

  • Mild sonication protocols: Brief sonication (3×10 seconds at 20% amplitude) can disrupt reversible aggregates without damaging VLP structure.

  • Size exclusion chromatography: Separates monomeric VLPs from aggregates based on hydrodynamic radius.

  • Density gradient ultracentrifugation: Sucrose or iodixanol gradients can effectively separate properly assembled VLPs from aggregates based on density differences .

Effective Monitoring Strategies:

  • Real-time DLS during storage: Tracks particle size evolution to determine aggregation kinetics under different conditions.

  • Stability-indicating assays: Regular negative-stain TEM and functional binding assays monitor both physical and functional stability over time.

How can researchers troubleshoot poor immune responses to SMIM4-VLPs in animal studies?

Resolving suboptimal immune responses to SMIM4-VLPs requires systematic investigation:

Antigen Presentation Factors:

  • Epitope accessibility: Poor responses may result from SMIM4 being partially obscured on the VLP surface. Cryo-EM analysis with asymmetric reconstruction can reveal whether structural rearrangements are needed to accommodate SMIM4 properly . Consider relocating SMIM4 to more exposed positions on the VLP scaffold.

  • Protein conformation: SMIM4 may not maintain its native conformation on VLPs. Comparing antibody recognition of linear versus conformational epitopes using synthetic peptides versus intact protein can identify conformational issues . Extended linkers or alternative insertion sites may improve conformational presentation.

  • Antigen density: Low SMIM4 incorporation efficiency reduces immunogenicity. Immunogold TEM analysis can quantify protein density on VLPs . Engineering higher-affinity interactions between SMIM4 and the VLP scaffold may increase incorporation.

Vaccine Formulation Variables:

  • Adjuvant compatibility: Some adjuvants may destabilize VLPs or mask SMIM4 epitopes. Testing multiple adjuvants (AddaVax, alum, CpG) can identify optimal formulations .

  • Dose optimization: VLP dose-response is often non-linear, with optimal doses typically between 1-50 μg per mouse. Dose escalation studies (0.1, 1, 10, 50 μg) can identify the most immunogenic dose .

  • VLP stability in vivo: Rapid degradation in vivo may limit antigen exposure. Using stabilizing mutations or protective formulations can improve persistence .

Immunization Protocol Refinements:

  • Route of administration: Switching from subcutaneous to intradermal or intramuscular routes can significantly impact immune response quality. Intradermal delivery targets skin-resident dendritic cells and often requires lower doses .

  • Prime-boost interval optimization: Extending the interval between prime and boost from 2 to 4 weeks may improve germinal center reactions and antibody maturation .

  • Heterologous prime-boost: Using alternate platforms (mRNA or protein) for priming or boosting can overcome immune tolerance or focus responses on the target antigen rather than the VLP scaffold .

Immune Response Assessment:

  • Comprehensive analysis: Measuring only IgG titers may miss other important responses. Include analyses of IgG subclasses, T-cell responses, and functional assays .

  • Kinetic evaluation: Collecting samples at multiple timepoints (days 14, 28, 42, 70) provides insight into response development and durability .

  • Antigen competition: The VLP scaffold may immunodominant over SMIM4. Comparing responses to both components can reveal antigenic competition .

Successful Intervention Strategies:
Based on studies with similar VLP systems, specific approaches have successfully improved immune responses:

InterventionPotential ImprovementImplementation Approach
Heterologous prime-boost2-5× higher antibody titersPrime with mRNA and boost with VLP
Optimal loop selectionImproved recognition of conformational epitopesMove epitopes to loops 1 or 2 rather than loop 3
Extended prime-boost intervalHigher antibody avidityIncrease interval from 2 to 4-8 weeks
Multiple boosting dosesSustained antibody titers for >5 monthsThree-dose schedule (0, 28, 56 days)

How should researchers interpret differences between in vitro binding assays and cryo-EM data for SMIM4-VLPs?

Resolving discrepancies between solution-based and structural analyses requires careful interpretation:

Common Discrepancy Patterns:

  • High binding in solution vs. low occupancy in cryo-EM: This pattern is frequently observed with VLP systems. Research with similar VLPs found that ELISA and sucrose density gradient data suggested high occupancy of binding sites, while cryo-EM reconstructions revealed low-resolution density, indicating low occupancy . These apparent contradictions stem from fundamental differences in the analytical approaches.

Methodological Explanations:

  • Sample preparation differences: The "on-grid binding" approach used for cryo-EM sample preparation differs significantly from solution-based binding conditions. This technical difference often results in lower occupancy during grid preparation compared to solution studies .

  • Averaging effects in symmetric reconstruction: Cryo-EM reconstructions using symmetry averaging can "dilute" the density of heterogeneously occupied features. If SMIM4 occupancy is variable across binding sites, its density may be averaged out in full reconstructions .

  • Conformational flexibility: SMIM4 may adopt multiple conformations on the VLP surface, appearing as diffuse or absent density in cryo-EM. Focused classification and asymmetric reconstruction approaches can reveal these flexible elements .

Resolution Strategies:

  • Focused classification: This cryo-EM analysis approach can reveal low-occupancy features by classifying particles based on local rather than global features . Apply a mask to individual SMIM4 binding sites and perform classification to identify particle subsets with bound SMIM4.

  • Asymmetric reconstruction: Analyzing particle subsets without imposing symmetry can reveal SMIM4 density that might be averaged out in symmetric reconstructions .

  • Cross-validation with orthogonal methods: Mass photometry or analytical ultracentrifugation can provide solution-based evidence of binding stoichiometry that bridges the gap between ELISA and cryo-EM data.

Biological Implications:

  • Steric hindrance effects: Cryo-EM data showing reorientation of binding sites upon SMIM4 binding suggests that accommodating transmembrane proteins requires structural rearrangement of the VLP scaffold . This may explain partial occupancy, as binding at one site influences adjacent sites.

  • Functional display considerations: Despite partial occupancy, VLPs displaying SMIM4 may still be functionally effective. Even with a fraction of sites occupied, the multivalent display on VLPs can significantly enhance immune recognition compared to monomeric proteins .

Interpretation Framework:

ObservationPossible ExplanationValidation Approach
High ELISA binding but low cryo-EM densitySample preparation differencesOptimize grid preparation to better preserve complexes
Reorientation of binding site in asymmetric reconstructionStructural accommodation of SMIM4Perform molecular dynamics simulations to model conformational changes
Focused classes show SMIM4 density not visible in symmetric mapsHeterogeneous occupancyQuantify occupancy percentage from focused classification results
Higher binding in solution studies than predicted from structural dataAvidity effects from multivalent displaySingle-molecule methods to measure true binding stoichiometry

How do researchers interpret VLP size heterogeneity in the context of SMIM4 presentation and function?

Size heterogeneity of SMIM4-VLPs requires nuanced interpretation:

Heterogeneity Patterns and Causes:

  • Discrete size populations: VLPs often assemble into particles with different triangulation numbers (commonly T=3 and T=4) . These represent distinct geometric arrangements of the same protein subunits rather than assembly defects.

  • SMIM4-induced variations: The integration of transmembrane proteins like SMIM4 can induce strain in the VLP lattice, potentially shifting the equilibrium between different particle sizes .

  • Expression system influences: Different expression systems produce VLPs with varying degrees of size heterogeneity. Mammalian cell-derived VLPs typically show greater size uniformity than those from bacterial systems .

Functional Implications:

  • Surface geometry effects: Different-sized VLPs present varying surface geometries, which impacts the spacing and orientation of displayed SMIM4 proteins. T=3 particles (60 protein subunits) present different epitope densities compared to T=4 particles (80 subunits) .

  • Immunological consequences: Particle size influences lymphatic drainage and uptake by antigen-presenting cells. Particles of 25-100 nm generally drain freely into lymphatic vessels, while larger aggregates may be retained at the injection site .

  • Stability differences: T=4 particles often exhibit greater stability than T=3 particles but may be more difficult to assemble when incorporating large transmembrane proteins .

Analytical Interpretation Strategies:

  • Resolution by class: Cryo-EM data should be classified and analyzed separately for each size class (e.g., T=3 versus T=4 particles) . Differences in SMIM4 presentation between classes may reveal size-dependent functional variations.

  • Comparative binding analysis: Fractionating different size populations and comparing their binding properties can reveal functional differences between particle sizes.

  • Immunogenicity correlation: Correlating immune responses with the proportion of different-sized particles in vaccine preparations can guide optimization toward the most immunogenic population.

Size Manipulation Approaches:

  • Assembly condition tuning: Modifying pH, ionic strength, and protein concentration during assembly can shift the distribution between different-sized particles .

  • Protein engineering: Strategic mutations in the VLP scaffold can bias assembly toward a preferred size class .

  • Purification-based selection: Size exclusion chromatography or density gradient centrifugation can separate discrete size populations for comparative studies .

Interpretative Framework:

VLP Size ClassTypical DiameterSubunit CountSMIM4 Presentation CharacteristicsFunctional Implications
T=325-30 nm60 subunitsHigher curvature, potentially more flexible presentation of SMIM4Better lymphatic drainage, potentially higher immunogenicity
T=435-40 nm80 subunitsLower curvature, more rigid spacing between SMIM4 proteinsGreater stability, potentially better for long-term storage
Mixed populations25-40 nmVariableHeterogeneous SMIM4 presentationMay provide broader epitope recognition but complicate manufacturing

How should researchers evaluate contradictory data regarding the immunogenicity of different VLP scaffold proteins for presenting SMIM4?

Resolving contradictions in immunogenicity data requires systematic analysis:

Identifying Sources of Contradiction:

  • Scaffold-specific effects: Different VLP scaffolds (HBc, TMV, NoV, CuMV) exhibit inherent differences in immunogenicity due to their size, symmetry, and intrinsic immunostimulatory properties .

  • Epitope presentation differences: The same SMIM4 protein may be presented differently depending on the insertion site and scaffold geometry, affecting epitope accessibility and recognition .

  • Experimental design variations: Differences in dose, route, adjuvant, schedule, and readout methods complicate direct comparisons between studies .

Analytical Resolution Approaches:

  • Side-by-side comparison studies: Conduct controlled experiments with multiple scaffold types displaying identical SMIM4 constructs under identical conditions to eliminate methodological variables .

  • Epitope accessibility analysis: Use monoclonal antibodies with defined epitope specificity to compare SMIM4 presentation across different scaffolds via competitive binding assays .

  • Immunogenicity breakdown: Analyze responses to both SMIM4 and the scaffold separately to determine whether immune competition or enhancement is occurring .

Interpretative Frameworks:

  • Scaffold-antigen relationship model: The relationship between scaffold and displayed antigen can be competitive (stronger responses to one reduce responses to the other), neutral (independent responses), or synergistic (scaffold enhances responses to the displayed antigen).

  • Immune mechanism classification: Categorize results based on the dominant immune mechanism (B-cell activation, T-cell help, innate immune stimulation) to interpret contradictions in a mechanism-specific context.

Reconciliation Strategies:

  • Heterologous prime-boost: When contradictory data suggests different scaffolds excel at different aspects of immunity, heterologous prime-boost regimens using multiple platforms can capitalize on their complementary strengths .

  • Application-specific optimization: Different applications (prophylactic vaccines, therapeutic vaccines, diagnostic reagents) may benefit from different scaffold properties, allowing contradictory data to inform application-specific selections.

Comparative Analysis Framework:

VLP ScaffoldSize RangeTypical T Cell ResponseAntibody Response CharacteristicsPAMP PropertiesOptimal Applications
HBc (Hepatitis B core)30-34 nmStrong CD4+ T cell helpHigh-titer antibodies, good for conformational epitopesMinimal TLR activationProphylactic vaccines
TMV (Tobacco Mosaic Virus)Rod-shaped, 300×18 nmModerateHigh-density epitope display on elongated surfacePlant-derived, potential TLR7/8 activationHigh-density antigen display
NoV (Norovirus)38-40 nmModerate to strongSuperior presentation in loops 1 and 2TLR2 activationConformational epitope presentation
CuMV (Cucumber Mosaic Virus)30 nmStrong with TT epitopeStable, long-lasting antibody responsesTLR7/8 ligands can be packaged insideHeterologous prime-boost regimens

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.