Recombinant Human Smoothened homolog (SMO)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Human Smoothened Homolog (SMO)

Recombinant Human Smoothened homolog (SMO) refers to a bioengineered version of the human SMO gene product, a 7-transmembrane G protein-coupled receptor (GPCR) critical for Hedgehog (Hh) signaling. SMO is expressed in recombinant systems (e.g., E. coli, mammalian cells, or wheat germ) for research purposes, enabling functional and structural studies of its role in development, cancer, and drug resistance .

Production and Expression Systems

Recombinant SMO is produced using diverse platforms to optimize yield, folding, and functional activity:

SystemProduct CharacteristicsApplicationsSource
E. coliFull-length or truncated proteins (e.g., CRD domain) Structural studies (NMR, X-ray)
Wheat germFragment (aa 653–787) for epitope tagging in antibodiesELISA, Western blot (e.g., Abcam ab114221)
Mammalian cellsFull-length SMO with tags (e.g., HA, FLAG) in lentiviral vectorsLive-cell imaging, ciliary trafficking
BaculovirusPost-translationally modified SMO for membrane integration studiesDrug-binding assays (e.g., vismodegib)

Functional Roles in Research

Recombinant SMO is pivotal for elucidating Hh pathway mechanisms and therapeutic resistance:

3.1. Hh Signaling and Ciliary Trafficking

  • Primary cilium localization: SMO translocates to cilia upon Hh ligand binding, enabling GLI activation . Mutations in ciliary trafficking domains (e.g., Trp→Leu) disrupt this process, leading to constitutive signaling .

  • GLI regulation: SMO binds and stabilizes GLI proteins, preventing their degradation and enabling nuclear translocation .

3.2. Small-Molecule Interactions

CompoundEffect on SMORelevanceSource
CyclopamineInhibits SMO by binding transmembrane domainBasal cell carcinoma treatment
VismodegibAntagonizes SMO in Hh-driven cancersResistance mutations (e.g., D473H) emerge
BudesonideBinds CRD, modulates SMO activationStructural studies of ligand binding

4.1. Cancer and Resistance Mechanisms

  • Overexpression in stromal cells: Pancreatic cancer-associated fibroblasts show elevated SMO, driving paracrine Hh signaling and therapy resistance .

  • Mutations in SMO: Gain-of-function mutations (e.g., G453S, L221R) confer resistance to SMO inhibitors like NVP-LDE-225, highlighting the need for novel targets .

4.2. Developmental Disorders

  • Loss-of-function mutations: Cause congenital anomalies (e.g., hypothalamic hamartoma, microcephaly) due to disrupted ciliary trafficking of Hh components .

Challenges in Recombinant SMO Research

  • Proper folding: CRD misfolding in E. coli systems may alter ligand-binding properties .

  • Post-translational modifications: Phosphorylation-dependent membrane localization is challenging to replicate in vitro .

Future Directions

Recombinant SMO will remain critical for:

  1. Structural biology: Resolving interactions between SMO and endogenous ligands.

  2. Drug discovery: Screening for CRD-targeting inhibitors to bypass resistance mutations.

  3. Personalized oncology: Modeling patient-specific SMO mutations to predict therapeutic responses.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that specific tag.
Synonyms
SMO; SMOH; Smoothened homolog; SMO; Protein Gx
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-787
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
SMO
Target Protein Sequence
RGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGA TSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLC QATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWY EDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVIL FYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMA GVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVS GICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINE TMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDC EIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIKKSK MIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVA RRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAP PPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDP FLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Uniprot No.

Target Background

Function
Smoothened homolog (SMO) is a G protein-coupled receptor that likely associates with the patched protein (PTCH) to mediate the transduction of hedgehog proteins' signals. Binding of sonic hedgehog (SHH) to its receptor patched is believed to prevent the normal inhibition of smoothened (SMO) by patched. SMO is essential for the accumulation of KIF7, GLI2, and GLI3 in the cilia. It interacts with DLG5 at the ciliary base, triggering the accumulation of KIF7 and GLI2 at the ciliary tip for GLI2 activation.
Gene References Into Functions
  1. This study reveals the crystal structure of the multi-domain human SMO in complex with a specially designed seven-transmembrane helices domain (TMD) ligand, shedding light on interactions between the cysteine-rich domain and TMD. Combining structural data with biophysical characterization and computer modeling results, the study proposes a mechanistic model of SMO activation. PMID: 28513578
  2. Case Report: Happle-Tinschert Syndrome is attributed to mosaic SMO mutations and represents a variant of Curry-Jones syndrome. PMID: 29335739
  3. Cholesterol within the bilayer is sufficient for constitutive Smoothened activation. Cholesterol effects occur independently of the lipid-binding Smoothened extracellular domain, a region that is dispensable for Patched1-Smoothened coupling. PMID: 29229834
  4. A somatic mutation in SMO likely accounts for the structural malformations and predisposition to form bowel hamartomas and myofibromas. The mutation burden in the involved tissues likely accounts for the variable manifestations PMID: 28386950
  5. Dual MET and SMO Inhibitors are potent antiproliferative agents in EGFR-Tyrosine kinase inhibitors resistant human non-small cell lung cancer. PMID: 28787156
  6. Smoothened-antagonists reverse alterations in Hedgehog signaling and chondrocyte primary cilium length in a homogentisic acid-induced model of alkaptonuria. PMID: 28019670
  7. SMO mutation is associated with olfactory groove meningiomas. PMID: 28082415
  8. SMO is covalently modified by cholesterol. This modification is regulated by Ptch1 and Hh and is essential for Hh signaling. PMID: 28344083
  9. A screen for analogs revealed another six molecules, with IC50 values in the low micromolar range. Importantly, one of the most active of the new antagonists continued to be efficacious at the D473H mutant of Smoothened, which confers clinical resistance to the antagonist vismodegib in cancer treatment. PMID: 27490099
  10. Our studies demonstrate an important role for smoothened and glioma-associated oncogene homology-1 in gastric cancer and suggest inhibition of the hedgehog pathway as a novel and potent strategy to treat gastric cancer patients PMID: 28675107
  11. The results suggest that Shh signaling plays an important role in rheumatoid arthritis-Fibroblast-like synoviocytes proliferation in a Smo-dependent manner. PMID: 26189371
  12. Mutations in the SMO gene are associated with Curry-Jones Syndrome. PMID: 27236920
  13. The Hedgehog pathway receptor SMO is an important regulator of gastric cancer paclitaxel resistance. PMID: 28350784
  14. Role of SMO-mediated Hedgehog signaling pathway in the proliferation and apoptosis of multiple myeloma cells PMID: 27959416
  15. Exogenous addition of 3beta,5alpha-dihydroxycholest-7-en-6-one, a naturally occurring B-ring oxysterol derived from 7-DHC that also accumulates in Smith-Lemli-Opitz syndrome, blocked Hedgehog signaling by inhibiting activation of the essential transduction component Smoothened, through a mechanism distinct from Smoothened modulation by other lipids. PMID: 27162362
  16. High SMO expression is associated with pancreatic and skin cancers. PMID: 26784250
  17. Crystal structures of the Hh signal transducer and oncoprotein Smoothened, a GPCR that contains two distinct ligand-binding sites: one in its transmembrane domain and one in the cysteine-rich domain PMID: 27437577
  18. Smoothened determines beta-arrestin-mediated removal of the G protein-coupled receptor Gpr161 from the primary cilium. PMID: 27002170
  19. The combined inhibition of SMO and EGFR exerted a strong antiproliferative activity. PMID: 26124204
  20. Suggest that hypoxia promotes SMO transcription through upregulation of MAML3 and RBPJ to induce proliferation, invasiveness, and tumorigenesis in pancreatic cancer. PMID: 26655998
  21. These findings suggest that miR-218 inhibits multidrug resistance of gastric cancer cells by down-regulating smoothened expression. PMID: 26261515
  22. Recipient SMO rs3824 polymorphism is associated with an increased risk of hepatocellular carcinoma recurrence following orthotopic liver transplantation. PMID: 25944162
  23. Strikingly, in basal cell carcinoma patients treated with Smo inhibitor, squamous cell cancers with RAS/MAPK activation emerged from the antecedent basal cell carcinoma tumors. PMID: 26130651
  24. This report discussed two different SMO mutations representing examples of primary or secondary resistance, respectively, to vismodegib in two distinct basal cell carcinoma cases PMID: 25306392
  25. The SMOF412E mutation was not detected in ameloblastoma. The BRAFV600E-activating mutation is a common event in ameloblastomas, occurring regardless of site or histological type. This mutation is also detected in odontogenic carcinomas. PMID: 25854168
  26. SMO was upregulated in gliomas and was associated with tumor grade and survival period. SMO inhibition suppressed the biological behaviors of glioma cells. SMO expression was inversely correlated with miR-326 and is a novel direct target of miR-326. PMID: 25173582
  27. SMO expression was significantly associated with better colorectal cancer-specific survival. PMID: 25023548
  28. The Smoothened receptor (SMO) mediates signal transduction in the hedgehog pathway, which is implicated in normal development and carcinogenesis. PMID: 25008467
  29. This analysis of small-molecule regulation of SMO and discussion of potential mechanisms for its endogenous regulation [review] PMID: 25785427
  30. SMO mutations are implicated in drug resistance in basal cell carcinoma. PMID: 25759019
  31. Mutations within the SMO protein are implicated in drug resistance in basal cell carcinoma. PMID: 25759020
  32. Studies indicate that Smoothened (Smo) inhibitor was beneficial for the treatment of advanced basal cell carcinoma (BCC). PMID: 24469022
  33. Signaling mediated by Smo contributes to acquired chemoresistance through activating the transcriptional factor Gli PMID: 24393163
  34. SMO mutation is associated with ameloblastoma. PMID: 24859340
  35. MicroRNA-338-3p could inhibit colorectal carcinoma cell invasion and migration by inhibiting smoothened expression. PMID: 24277750
  36. The structure of the Smo receptor will promote the development of small molecules interacting with a key therapeutic target with interests in regenerative medicine and cancer.[review] PMID: 24148123
  37. miR-338-3p could suppress colorectal carcinoma growth by inhibiting SMO protein expression. PMID: 23599646
  38. We observed a strong correlation between higher SMO and SHH expression levels with poorer overall survival. PMID: 23379358
  39. Smo antagonism led to reduced Hedgehog pathway activity, resulting in decreased cell proliferation and induction of apoptosis via the intrinsic pathway in the esophageal cancer cells PMID: 23915072
  40. GSA-10 allows the pharmacological characterization of a novel Smo active site. PMID: 23448715
  41. Downregulation of miR-326 may be a possible mechanism for unrestricted activation of the Smo signal transducer of the oncogenic Hedgehog pathway in chronic myeloid leukemia PMID: 23341351
  42. Nonclassical activation of Hedgehog signaling enhances multidrug resistance and makes cancer cells refractory to Smoothened-targeting Hedgehog inhibition PMID: 23508962
  43. Crystal structure of the transmembrane domain of the human SMO receptor bound to the small-molecule antagonist LY2940680 at 2.5 A resolution PMID: 23636324
  44. A subset of meningiomas lacking NF2 alterations harbored recurrent oncogenic mutations in AKT1 (p.Glu17Lys) and SMO (p.Trp535Leu) and exhibited immunohistochemical evidence of activation of these pathways. PMID: 23334667
  45. High SMO expression is associated with postoperative liver metastasis in colon cancer. PMID: 23098507
  46. SMO mutations, which activate Hedgehog signaling, were identified in ~5% of non-NF2 mutant meningiomas PMID: 23348505
  47. High SMO expression is associated with colorectal cancer. PMID: 22901214
  48. This study shows that hedgehog signaling rewires cellular metabolism; Smo-dependent noncanonical signal rewires metabolism in vitro and in vivo. PMID: 23063129
  49. Different pools of Smo move into cilia through distinct mechanisms PMID: 22864913
  50. The effects of oxysterols on Hedgehog signaling are exquisitely stereoselective, consistent with the hypothesis that they function through a specific protein target. PMID: 22231273

Show More

Hide All

Database Links

HGNC: 11119

OMIM: 601500

KEGG: hsa:6608

STRING: 9606.ENSP00000249373

UniGene: Hs.437846

Involvement In Disease
Curry-Jones syndrome (CRJS)
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is Recombinant Human Smoothened protein and what is its role in cellular signaling?

Recombinant Human Smoothened protein (SMO) is a G protein-coupled receptor belonging to the Frizzled (FzD) class that functions as the central transducer in the Hedgehog (Hh) signaling pathway . SMO associates with the patched protein (PTCH) to transduce hedgehog protein signaling . The binding of sonic hedgehog (SHH) to patched prevents the inhibition of SMO by patched, allowing SMO to become active . When active, SMO binds to and sequesters protein kinase A catalytic subunit PRKACA at the cell membrane, preventing PRKACA-mediated phosphorylation of GLI transcription factors . This releases GLI proteins from inhibition and allows for transcriptional activation of hedgehog pathway target genes .

In experimental systems, commercially available recombinant human SMO is typically produced as a fragment protein (653-787 amino acids), expressed in wheat germ, and is suitable for various experimental techniques including SDS-PAGE, ELISA, and Western blotting .

What structural domains characterize SMO and how do they contribute to its function?

SMO contains several key structural domains that are critical for its function:

  • Cysteine-Rich Domain (CRD): This extracellular domain is indispensable for SMO function and downstream Hedgehog signaling . The CRD serves as a binding site for small molecule modulators including glucocorticoids (such as budesonide) and hydroxyl-sterols (such as 20-hydroxycholesterol) . Recent structural studies have resolved the NMR solution structure of the Drosophila Smo CRD, revealing its potential role in binding endogenous ligands .

  • Transmembrane Domain: As a GPCR, SMO contains a seven-transmembrane domain structure typical of this receptor family .

  • Intracellular Domain: This region is involved in interactions with downstream signaling proteins and is subject to regulatory phosphorylation .

The CRD is particularly important for SMO dimerization, as CRD deletion mutants fail to dimerize, suggesting this domain governs SMO oligomerization . The disulfide bridges within the CRD are essential for proper protein folding, and mutation of cysteine residues to alanine results in ER retention due to misfolding, though interestingly, these misfolded proteins resist degradation .

How do phosphorylation events regulate SMO activation and trafficking?

SMO activation and trafficking are regulated by a complex series of phosphorylation events involving multiple kinases:

  • Sequential Kinase Action: The activation of SMO involves the sequential and additive action of protein kinase A (PKA), casein kinase I (CKI), and the Fused (FU) kinase . This sequential phosphorylation is crucial for proper SMO stabilization and localization.

  • Endocytosis and Recycling: Hedgehog promotes the stabilization of SMO by switching its fate after endocytosis toward recycling rather than degradation . This effect is dependent on the phosphorylation status of SMO.

  • Apico-Basal Distribution: In polarized epithelial cells, high levels of Hedgehog lead to the enrichment of SMO in the basal domain of the cell membrane, an effect mediated by Fused kinase . This suggests that the morphogenetic effects of Hedgehog are linked to the apico-basal distribution of SMO.

  • GRK-Mediated Phosphorylation: Phosphorylation by G protein-coupled receptor kinases (GRKs) is specifically required for SMO interaction with protein kinase A catalytic subunit PRKACA .

Experimental blocking of endocytosis using temperature-sensitive mutations of Dynamin orthologs (shibire in Drosophila) leads to accumulation of surface SMO, particularly in the apical region of cells, highlighting the importance of endocytosis in regulating SMO distribution .

What experimental methods are most effective for studying SMO localization and trafficking?

Several sophisticated methods have proven effective for studying SMO localization and trafficking:

  • SNAP-Tag Labeling: Using SNAP-SMO fusion proteins expressed from endogenous promoters (e.g., from BAC constructs) allows specific labeling of the cell surface fraction of SMO using non-liposoluble fluorescent SNAP ligands . This approach enables visualization and quantification of surface SMO without detecting internal pools.

  • Subcellular Distribution Analysis: Quantifying SMO distribution along the apico-basal axis can be performed using confocal microscopy with XZ projections . The epithelium can be divided into three regions:

    • Apical region (typically defined as the uppermost 15% based on markers like Discs large)

    • Basal region (typically the lowermost 10%)

    • Lateral/intermediate region between these boundaries

  • Compartmentalized Analysis in Model Systems: In the Drosophila wing imaginal disc, SMO behavior can be studied across different regions with varying Hedgehog exposure, identified through co-immunodetection of transcription factors like CI :

    • Posterior compartment (where CI is not expressed)

    • CI-R region (where CI is processed to its repressor form)

    • CI-F region (medium to low Hedgehog levels)

    • CI-A region (highest Hedgehog signaling)

  • Genetic Temperature-Sensitive Systems: Using thermosensitive mutations (e.g., hhᵗˢ² or shiᵗˢ) allows for temporal control of protein function to study acute effects on SMO trafficking .

  • NMR Spectroscopy: For studying SMO CRD structure and ligand interactions, 2D ¹H-¹⁵N HSQC spectra using ¹⁵N and ¹³C labeled protein preparations has been effective . This technique allows detection of chemical shift perturbations upon ligand binding.

How can researchers effectively design experiments to distinguish between canonical and non-canonical SMO functions?

Distinguishing between canonical (Hedgehog pathway-dependent) and non-canonical functions of SMO requires carefully designed experimental approaches:

  • Genetic Manipulation Strategies:

    • Use of SMO constructs with mutations in specific domains (e.g., CRD deletion or mutation of specific phosphorylation sites) can help separate different functions .

    • CRISPR/Cas9-mediated generation of domain-specific mutations rather than complete knockouts.

    • Comparison of phenotypes between SMO knockdown and GLI transcription factor knockdown to identify divergent effects.

  • Subcellular Localization Analysis:

    • Since canonical SMO signaling is associated with cilia, experiments comparing ciliary versus non-ciliary populations of SMO can help distinguish pathway-specific functions .

    • Co-localization studies with raft microdomain markers can help identify non-canonical functions, such as SMO's role in regulating IGF1R levels .

  • Downstream Pathway Analysis:

    • Simultaneous monitoring of canonical Hedgehog targets (GLI-mediated transcription) and non-canonical pathways (e.g., AKT signaling) following SMO manipulation .

    • Use of pathway-specific inhibitors to block canonical or non-canonical pathways while assessing SMO function.

  • Cell Type-Specific Considerations:

    • Comparison of SMO functions in ciliated versus non-ciliated cell types.

    • Analysis of SMO activities in normal versus cancer cells, as non-canonical functions appear particularly relevant in cancer contexts .

  • Temporal Regulation:

    • Use of rapid induction/inhibition systems to distinguish direct versus indirect effects of SMO on various cellular processes.

What are the current challenges in developing and working with recombinant SMO for structural studies?

Researchers face several challenges when working with recombinant SMO for structural studies:

  • Protein Production and Stability:

    • Full-length SMO is difficult to express and purify due to its seven transmembrane domains; most commercial recombinant proteins offer only fragments (typically the CRD or C-terminal domains) .

    • Maintaining the native conformation of SMO is challenging, particularly for the CRD which relies on critical disulfide bridges for proper folding .

  • Post-Translational Modifications:

    • Recombinant expression systems may not recapitulate the complex pattern of phosphorylation needed for SMO activity .

    • Different expression systems (bacterial, insect, mammalian) yield proteins with varying degrees of post-translational modifications.

  • Functional Assessment:

    • Confirming that recombinant SMO retains functional activity requires specialized assays, particularly challenging for a protein whose function depends on membrane localization and protein-protein interactions .

  • Structural Analysis Methods:

    • While NMR has been successfully used for the CRD, full-length SMO poses challenges for both X-ray crystallography and cryo-EM due to its flexibility and membrane-embedded nature .

    • Preparing SMO in appropriate detergent micelles or nanodiscs that maintain native conformation is technically challenging.

  • Species-Specific Differences:

    • Structural and functional differences between human and model organism (e.g., Drosophila) SMO proteins necessitate careful consideration when translating findings across species .

How is SMO dysregulation implicated in cancer, and what experimental models best recapitulate these mechanisms?

SMO dysregulation contributes to cancer development through both canonical and non-canonical mechanisms:

  • Canonical Hedgehog Pathway Activation:

    • Aberrant SMO activation contributes to medulloblastoma, basal cell carcinoma, and rhabdomyosarcoma through hyperactivation of GLI-mediated transcription .

    • Mutations that render SMO constitutively active (bypassing PTCH inhibition) are found in a subset of these cancers.

  • Non-Canonical Cancer-Promoting Functions:

    • SMO regulates IGF1R levels and associated AKT signaling in lymphoma and breast cancer cells .

    • Elevated SMO levels show strong correlation with elevated IGF1R levels and reduced survival in Diffuse Large B-Cell Lymphoma (DLBCL) .

    • As an integral component of raft microdomains, SMO maintains IGF1R levels and influences AKT activation independently of canonical Hedgehog signaling .

Recommended Experimental Models:

  • Patient-Derived Xenografts (PDXs):

    • Particularly valuable for maintaining tumor heterogeneity and studying complex SMO-related signaling networks in vivo.

    • Allow for testing targeted therapies against SMO in a clinically relevant context.

  • Cell Line Models with Varying SMO Expression Levels:

    • Comparing matched cell lines with SMO knockdown/knockout versus overexpression can help delineate dose-dependent effects .

    • Particularly useful for studying non-canonical functions in specific cancer types like DLBCL where SMO-IGF1R correlation has been observed .

  • Genetic Mouse Models:

    • Conditional SMO activation or deletion in specific tissues can help understand tissue-specific oncogenic mechanisms.

    • Particularly relevant for SMO-driven cancers like medulloblastoma and basal cell carcinoma.

  • 3D Organoid Cultures:

    • Bridge the gap between 2D cell culture and animal models, allowing for study of SMO function in a more physiologically relevant context.

    • Can be derived from both normal and tumor tissues to study transformation processes.

What methodological considerations should be addressed when evaluating SMO-targeting compounds in experimental settings?

When evaluating compounds targeting SMO, researchers should address several methodological considerations:

  • Binding Site Specificity:

    • SMO has multiple distinct ligand-binding domains including the orthosteric site in the transmembrane core (binds cyclopamine) and the CRD (binds compounds like 20-hydroxycholesterol and budesonide) .

    • Compounds should be characterized for their specific binding site using techniques like site-directed mutagenesis and competition binding assays.

  • Functional Readouts:

    • Measuring both immediate SMO conformational changes and downstream pathway activation:

      • GLI transcriptional activity for canonical pathway effects

      • Non-canonical readouts such as AKT phosphorylation or IGF1R levels

      • SMO membrane localization and trafficking changes

  • Cellular Context Dependencies:

    • Testing compounds across multiple cell types with varying levels of Hedgehog pathway components.

    • Evaluating effects in both ciliated and non-ciliated cells to capture context-dependent activities.

    • Considering the phosphorylation state of SMO, which may affect compound binding and efficacy .

  • Resistance Mechanisms:

    • Evaluate compound efficacy against known SMO mutations that confer resistance to existing SMO inhibitors.

    • Consider combination approaches targeting both canonical and non-canonical pathways, particularly in cancer models .

  • Pharmacokinetic/Pharmacodynamic Considerations:

    • For in vivo studies, assess compound distribution to relevant tissues, particularly considering the blood-brain barrier for CNS tumors.

    • Evaluate duration of pathway inhibition relative to compound half-life.

How can SMO tracking techniques be applied to study drug resistance mechanisms in Hedgehog pathway-dependent cancers?

Advanced SMO tracking techniques offer valuable insights into drug resistance mechanisms:

  • Real-Time Visualization of SMO Trafficking:

    • SNAP-tag or other bioorthogonal labeling approaches allow for live-cell imaging of SMO localization changes in response to drugs and during resistance development .

    • This can reveal altered trafficking patterns, such as changes in endocytosis/recycling balance or subcellular distribution that accompany resistance.

  • Correlating SMO Localization with Function:

    • Simultaneous monitoring of SMO localization along the apico-basal axis and downstream signaling activity can identify functionally distinct pools of the receptor .

    • Resistant cells may show redistributed SMO with maintained signaling despite drug presence.

  • Identifying Bypass Mechanisms:

    • Tracking SMO while simultaneously monitoring non-canonical pathways can reveal when cells shift to alternative signaling mechanisms like the IGF1R-AKT axis .

    • Correlation analyses between SMO localization patterns and activation of various downstream pathways can identify escape routes.

  • Mutation-Specific Trafficking Patterns:

    • Comparing trafficking patterns of wild-type versus mutant SMO that confer drug resistance can reveal mechanistic insights.

    • Some resistance mutations may alter SMO's ability to interact with the endocytic machinery or affect its phosphorylation-dependent trafficking.

  • Combination Therapy Evaluation:

    • SMO tracking during combination treatments targeting both canonical and non-canonical pathways can help optimize treatment regimens.

    • Visualizing changes in SMO pools during treatment can identify which cellular reservoirs of SMO remain active despite therapy.

What are the optimal expression systems and purification strategies for obtaining functional recombinant SMO protein?

Obtaining functional recombinant SMO requires careful consideration of expression systems and purification strategies:

Expression Systems Comparison:

  • Wheat Germ Cell-Free System:

    • Successfully used for producing fragments of human SMO (653-787 aa range) .

    • Advantages: Eukaryotic translation machinery, good for disulfide bond formation, fewer problems with protein toxicity.

    • Limitations: Lower yields, typically used for protein fragments rather than full-length.

  • Insect Cell Expression (Sf9, Sf21, High Five):

    • Suitable for full-length GPCRs including SMO.

    • Advantages: Post-translational modifications, proper membrane insertion, higher yield than mammalian systems.

    • Limitations: Glycosylation patterns differ from human cells.

  • Mammalian Expression Systems (HEK293, CHO):

    • Most physiologically relevant for human SMO.

    • Advantages: Native-like post-translational modifications, particularly phosphorylation patterns crucial for SMO function .

    • Limitations: Lower yields, higher cost, challenging to scale up.

Purification Strategies:

  • Affinity Tags:

    • N-terminal tags (e.g., His, FLAG) generally preferred as C-terminal modifications may interfere with downstream signaling functions.

    • Tandem affinity purification (e.g., His-FLAG) can improve purity.

  • Detergent Selection:

    • Critical for maintaining SMO structure and function during solubilization.

    • Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) often suitable for SMO.

    • Consider detergent screening to identify optimal conditions.

  • Membrane Scaffold Systems:

    • Nanodiscs or SMALPs (Styrene Maleic Acid Lipid Particles) can maintain SMO in a more native-like lipid environment.

    • Particularly valuable for structural and functional studies requiring a membrane context.

  • Stabilization Strategies:

    • Addition of ligands during purification can improve stability.

    • Targeted mutations to improve thermostability while maintaining function.

    • Fusion partners (e.g., T4 lysozyme) may enhance stability for structural studies.

What analytical techniques are most informative for characterizing SMO-ligand interactions and conformational changes?

Multiple analytical techniques provide complementary information about SMO-ligand interactions:

  • NMR Spectroscopy:

    • 2D ¹H-¹⁵N HSQC spectra using ¹⁵N and ¹³C labeled protein preparations can detect specific residues involved in ligand binding .

    • Chemical Shift Perturbation (CSP) analysis allows mapping of binding interfaces.

    • Particularly effective for studying interactions with the CRD, as demonstrated with budesonide binding to both Drosophila and human SMO CRDs .

  • Surface Plasmon Resonance (SPR):

    • Provides real-time binding kinetics (kon and koff rates) and affinity measurements.

    • Can be used to compare binding of different ligands to wild-type and mutant SMO constructs.

    • Allows detection of conformational changes upon ligand binding.

  • Thermal Shift Assays:

    • Differential Scanning Fluorimetry (DSF) can detect stabilization of SMO upon ligand binding.

    • Useful for rapid screening of potential ligands and optimization of buffer conditions.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps regions of SMO that undergo conformational changes upon ligand binding.

    • Particularly valuable for identifying allosteric effects distant from the binding site.

  • Fluorescence-Based Techniques:

    • FRET (Förster Resonance Energy Transfer) sensors incorporated into SMO can detect conformational changes in real-time.

    • Fluorescence Polarization (FP) assays can measure direct binding of fluorescently labeled ligands.

  • Computational Approaches:

    • Molecular Dynamics simulations can model conformational changes upon ligand binding.

    • In silico docking studies, validated by experimental data, can predict binding modes of novel ligands.

How should researchers design experiments to study the interplay between SMO phosphorylation states and subcellular trafficking?

Studying the complex relationship between SMO phosphorylation and trafficking requires multifaceted experimental approaches:

  • Phosphorylation Site Mapping and Mutation:

    • Mass spectrometry to identify phosphorylation sites under different conditions (basal, Hedgehog stimulation, different kinase activators/inhibitors).

    • Generation of phospho-mimetic (Ser/Thr to Asp/Glu) and phospho-deficient (Ser/Thr to Ala) mutations at key sites to study their individual and combined effects on trafficking .

    • Creation of phosphorylation state-specific antibodies to track distinct SMO populations.

  • Kinase Manipulation Strategies:

    • Selective inhibitors or genetic knockdown/knockout of specific kinases (PKA, CK1, FU) to determine their individual contributions .

    • Sequential inhibition experiments to establish the order of kinase action and identify decision points in trafficking pathways.

    • Constitutively active kinase constructs to drive phosphorylation without upstream pathway activation.

  • Tracking Surface vs. Internal SMO Populations:

    • SNAP-tag labeling approaches to specifically label and follow surface SMO populations .

    • Pulse-chase experiments to determine the fate of internalized SMO under different phosphorylation conditions.

    • Subcellular fractionation combined with phospho-specific western blotting to correlate phosphorylation state with membrane localization.

  • Visualization of Trafficking Dynamics:

    • Live-cell imaging with tagged SMO constructs to follow trafficking in real-time.

    • Colocalization with endocytic pathway markers (early endosomes, recycling endosomes, lysosomes) to determine the fate of internalized SMO.

    • TIRF microscopy to visualize events at or near the plasma membrane with high resolution.

  • Manipulation of Trafficking Machinery:

    • Temperature-sensitive dynamin mutations (e.g., shiᵗˢ) or chemical inhibitors to block endocytosis .

    • Rab GTPase mutants to interfere with specific trafficking pathways (e.g., dominant-negative Rab11 to block recycling).

    • Correlation of trafficking blockade with changes in SMO phosphorylation state.

How might single-cell approaches advance our understanding of heterogeneous SMO activity in tissue contexts?

Single-cell technologies offer powerful approaches to understand SMO heterogeneity in complex tissues:

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Reveals cell-specific transcriptional responses to Hedgehog/SMO signaling within heterogeneous tissues.

    • Can identify previously unrecognized cell populations with unique SMO-dependent gene signatures.

    • Correlation of SMO expression levels with downstream pathway components and target genes at single-cell resolution.

  • Single-Cell Proteomics and Phosphoproteomics:

    • Emerging techniques to measure protein levels and phosphorylation states in individual cells.

    • Could reveal cell-specific differences in SMO phosphorylation patterns and correlate with functional outcomes.

    • Potential to identify divergent downstream signaling networks activated by SMO in different cell types.

  • Spatial Transcriptomics and Proteomics:

    • Combines single-cell resolution with spatial information to map SMO activity gradients within tissues.

    • Particularly valuable for understanding morphogen-like functions of Hedgehog/SMO signaling during development and in tumors.

    • Can reveal how positional information affects SMO trafficking and signaling output.

  • Live-Cell Single-Molecule Imaging:

    • Tracking of individual SMO molecules can reveal subpopulations with distinct dynamic behaviors.

    • Single-particle tracking can determine how SMO diffusion, clustering, and endocytosis rates vary between cells and microenvironments.

    • Super-resolution microscopy approaches can visualize SMO nano-clusters and interactions with signaling partners.

  • Multimodal Single-Cell Analysis:

    • Integration of transcriptomic, proteomic, and imaging data from the same cells.

    • Could link SMO localization patterns with specific transcriptional outputs at single-cell resolution.

    • May reveal how cellular context influences SMO function and identify new regulatory relationships.

What are the most promising emerging technologies for studying SMO-interacting partners and complexes?

Several cutting-edge technologies show promise for elucidating SMO interaction networks:

  • BioID and TurboID Proximity Labeling:

    • Fusion of biotin ligase to SMO allows identification of proteins in close proximity in living cells.

    • Can capture transient interactions and map the SMO "interactome" in different subcellular locations.

    • Comparing interactomes of wild-type versus mutant SMO can identify interaction partners relevant to specific functions.

  • CRISPR-Based Screening Approaches:

    • Genome-wide or targeted CRISPR screens (knockout, activation, or interference) to identify genes affecting SMO trafficking, stability, or signaling.

    • Base editing or prime editing to introduce precise mutations in potential interaction partners.

    • Optical pooled screens combining CRISPR perturbations with imaging readouts to identify genes affecting SMO localization.

  • Cryo-Electron Tomography:

    • Visualizing SMO in its native cellular environment at molecular resolution.

    • Could reveal SMO organization in cilia or raft microdomains and identify associated protein complexes.

    • Particularly valuable for understanding how SMO organizes signaling hubs in specific membrane domains.

  • Mass Spectrometry-Based Interactomics:

    • Crosslinking Mass Spectrometry (XL-MS) to capture and identify interaction interfaces.

    • Thermal Proximity Coaggregation (TPCA) to identify proteins that coaggregate with SMO upon heating, indicating physical proximity.

    • Quantitative interactomics to compare SMO binding partners under different conditions or phosphorylation states.

  • Optogenetic and Chemogenetic Tools:

    • Light- or drug-inducible SMO activation to study temporal aspects of complex formation.

    • Optogenetic control of SMO localization to determine how subcellular positioning affects interaction partner recruitment.

    • Split protein complementation approaches combined with optogenetics to visualize specific interactions in real-time.

How might researchers best integrate canonical and non-canonical SMO functions into a unified model of SMO biology?

Developing a unified model of SMO biology requires systematic integration of diverse datasets and conceptual frameworks:

  • Multi-Omics Data Integration Approaches:

    • Combining transcriptomic, proteomic, metabolomic, and lipidomic data from cells with manipulated SMO function.

    • Network analysis to identify points of convergence and divergence between canonical and non-canonical pathways.

    • Mathematical modeling to predict how SMO signal distribution changes under different conditions.

  • Dynamic 4D Cell Mapping:

    • Time-resolved tracking of SMO localization, phosphorylation state, and interaction partners.

    • Correlation with downstream signaling events in canonical (GLI activation) and non-canonical (IGF1R/AKT) pathways .

    • Development of biosensors to simultaneously monitor multiple SMO-dependent pathways in living cells.

  • Context-Dependent Signaling Maps:

    • Systematic comparison of SMO function across different cell types, developmental stages, and disease states.

    • Identification of cell type-specific factors that determine whether SMO engages canonical versus non-canonical pathways.

    • Analysis of how lipid composition of membrane microdomains affects SMO signaling output.

  • Structural Biology Integration:

    • Relating conformational states of SMO to specific signaling outputs.

    • Understanding how different ligands or phosphorylation patterns bias SMO toward distinct functional states.

    • Computational modeling of how SMO structural dynamics influence downstream pathway activation.

  • Evolutionary Perspective:

    • Comparative analysis of SMO function across species to identify conserved core mechanisms versus evolved specializations.

    • Understanding how canonical versus non-canonical functions evolved and their relative importance in different organisms.

    • Identifying structural features that facilitate dual functionality in both development and disease contexts.

  • Systems Biology Framework:

    • Development of computational models that incorporate both canonical and non-canonical functions.

    • In silico prediction of how perturbations to specific SMO domains or modifications would affect the balance between different signaling outputs.

    • Integration of SMO signaling into broader cellular signaling networks to understand cross-talk and compensatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.