Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial

Shipped with Ice Packs
In Stock

Description

Functional Relevance

SLC5A2 is a low-affinity, high-capacity sodium-glucose symporter critical for renal glucose reabsorption:

  • Mechanism: Cotransports Na⁺ and glucose with a 1:1 coupling ratio, driven by the sodium electrochemical gradient .

  • Localization: Expressed in the S1 segment of the proximal convoluted tubule, where it reabsorbs ~90% of filtered glucose .

  • Pathway Collaboration: Works in series with high-affinity SLC5A1 (SGLT1) in the S3 segment for efficient glucose recovery .

A. Disease Modeling

  • Renal Glucosuria (GLYS): Mutations in SLC5A2 (e.g., p.S293C) cause familial renal glucosuria, characterized by urinary glucose excretion without hyperglycemia . Recombinant SLC5A2 aids in studying these mutations’ structural and functional impacts.

  • Diabetes Therapeutics: Used to validate SGLT2 inhibitors (e.g., dapagliflozin), which mimic genetic inactivation of SLC5A2 to promote glucosuria and lower blood glucose .

B. Drug Development

  • Inhibitor Binding Studies: Hydrogen-bond interactions with residues Asn51 and Glu75 in SLC5A2’s active site are critical for inhibitor design .

  • CRISPR/Cas9 Models: SLC5A2-null mice show attenuated glucose-lowering effects of vertical sleeve gastrectomy, highlighting its role in metabolic surgery outcomes .

Disease-Associated Mutations

Identified pathogenic variants in SLC5A2 and their clinical impacts:

MutationPhenotypeInheritanceCitation
p.S293CFamilial renal glucosuriaCo-dominant
Exon 1 deletionLoss of Na⁺ binding and transportRecessive

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.
Note: If you have specific requirements for the glycerol content, please indicate them in your order remarks.
For lyophilized powder delivery forms, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format preferences, please include your requirements in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of the product is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Synonyms
SLC5A2; SGLT2; Sodium/glucose cotransporter 2; Na(+/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2
Datasheet & Coa
Please contact us to get it.
Expression Region
1-102aa
Mol. Weight
30.5kDa
Protein Length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Source
in vitro E.coli expression system
Species
Homo sapiens(Human)
Target Names
Target Protein Sequence
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Sodium-dependent glucose transporter. Exhibits a Na(+) to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is facilitated by the coordinated action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter, arranged in series along kidney proximal tubules.
Gene References Into Functions
  1. SGLT2-I therapy is a potential new strategy for the treatment of HCC. PMID: 29205334
  2. Sodium-glucose cotransporter-2 (SGLT2) is selectively expressed in the human kidney, where it mediates reabsorption of filtered glucose with a high capacity. It may be overactive in patients with diabetes, particularly in the early, hyperfiltering stage of the disease. As a therapeutic target, SGLT2 has been successfully engaged by orally active, selective agents. [review] PMID: 28506519
  3. In this study, more than 90% of patients were on Forxiga or Invokana. Merck and Pfizer are also collaborating to bring an SGLT2 rival drug, ertugliflozin, to market, as well as on two combinations containing the drug to treat type 2 diabetes. PMID: 28398306
  4. Canagliflozin, an orally active inhibitor of sodium glucose co-transporter 2, is approved for the treatment of type-2 diabetes mellitus. Food did not affect canagliflozin pharmacokinetics. PMID: 27136908
  5. C-peptide-based measurements of insulin secretion are appropriate for assessing beta-cell function in SGLT2 inhibitor canagliflozin-treated participants. PMID: 27127999
  6. The novel pathogenic SLC5A2 mutation p.S293C was responsible for the onset of FRG PMID: 28365451
  7. Molecular Interaction of Anti-Diabetic Drugs With Acetylcholinesterase and Sodium Glucose Co-Transporter 2. PMID: 28387957
  8. The key pharmacodynamic effects of SGLT2 inhibitors and the clinical evidence that support the rationale for the use of SGLT2 inhibitors in patients with HF who have T2D. Because these favorable effects presumably occur independent of blood glucose lowering, we also explore the potential use of SGLT2 inhibition in patients without T2D with HF or at risk of HF, such as in patients with coronary artery disease PMID: 29061576
  9. Results provide evidence that common genetic variants in the SLC5A2 gene do not affect diabetes-related metabolic traits in subjects at increased risk of type 2 diabetes. PMID: 28134748
  10. SGLT2/MAP17 functions as a low-affinity Na(+)-glucose cotransporter in the kidney. PMID: 28592437
  11. reported nominal effects of individual SLC5A2 variants on fasting and post-challenge glucose levels may probably not be mediated by altered glucagon release PMID: 28472182
  12. Findings suggest that there are subtypes of T2DM characterized by different urinary glucose excretion and cardiovascular risk factors. SLC5A2 and HNF1A mutations partially explain renal glycosuria in patients with T2DM. PMID: 28324025
  13. SGLT2 inhibitors combined with insulin might be an efficient and safe treatment modality for T1DM patients. PMID: 28399981
  14. Data suggest that ketoacidosis (ketonuria/ketonemia) associated with the use of sodium-glucose cotransporter 2 protein (SGLT-2) inhibitors needs further research. PMID: 27085074
  15. In both men and women, grip strength increased in both hands after sodium-glucose cotransporter 2 protein (SGLT2) inhibitor treatment. PMID: 27038414
  16. Data suggest that SGLT2 plays a central role in energy metabolism and renal elimination of circulating glucose; targeted inhibition of SGLT2 alters energy metabolism in diabetes and obesity. PMID: 26403227
  17. Mutations in the SLC5A2 gene did not find any evidence that chronic loss of glucose in the urine would protect from deterioration of the glucose tolerance over time. PMID: 26735923
  18. Data suggest that SGLT2 is a transporter found in proximal renal tubules, responsible for reabsorption of most of glucose filtered by the kidney; inhibition of SGLT2 lowers blood glucose level by promoting urinary excretion of excess glucose. [REVIEW] PMID: 26362302
  19. Data show that thiosugars bind to sodium-glucose co-transporters vSGLT and hSGLT2 stronger and dissociate more slowly than sugars. PMID: 26260238
  20. SGLT2 is functionally expressed in pancreatic and prostate adenocarcinomas PMID: 26170283
  21. Results identified six SLC5A2 variants including four novel variants in Chinese familial renal glucosuria. Variant SLC5A2 proteins had altered expression levels and patterns in addition to significantly lower glucose transport in cultured cells. PMID: 25339128
  22. SGLT2 inhibitor canagliflozin can be coadministered with oral contraceptives, warfarin, or digoxin without dose adjustments. PMID: 25345427
  23. SGLT2 is inhibited with dapagliflozin in pancreatic alpha cells, which triggers glucagon secretion PMID: 25894829
  24. Sodium glucose cotransporter 2 inhibitor empagliflozin is not associated with prolonged QT interval. PMID: 23617452
  25. A single dose of canagliflozin, a sodium glucose co-transporter 2 inhibitor, 300 mg reduced both fasting and postprandial PG. PMID: 25110280
  26. A possible role of common genetic variation in SLC5A2 in the control of glucose homeostasis. PMID: 23651029
  27. Studies indicate that glucose is present in the glomerular filtrate and is reabsorbed by a group of transport proteins in the renal tubular epithelium, with sodium glucose transporter (SGLT)-2 quantitatively the most important. PMID: 23714218
  28. Data suggest that SGLT2 plays a role in tubular apoptosis in diabetic nephropathy; SGLT2-mediated, high glucose-induced generation of reactive oxygen species appears to augment apoptosis of renal tubular cells. PMID: 23508966
  29. It was concluded that human SGLT1 and SGLT2 are regulated by different mechanisms and suggest that insulin is an SGLT2 agonist in vivo. PMID: 22673616
  30. A total of 21 different SLC5A2 mutations were detected in a cohort of 23 unrelated Korean children with Familial renal glucosuria PMID: 22314875
  31. In this review, we summarize the available data concerning the mechanism of action, efficacy, and safety of this novel antidiabetic class of therapeutic agents. PMID: 22528597
  32. analysis of SGLT2 inhibitors containing the 1,2,3-triazole motif and evaluation of their urinary glucose excretion PMID: 22079028
  33. TS-071 inhibited SGLT2 activity in a concentration-dependent manner. PMID: 21410690
  34. Our data suggest a role of SGLT2 genetic variation in the regulation of glucose homeostasis and promote pharmacogenomic studies to clarify the efficacy of antidiabetic treatment by SGLT2 inhibitors PMID: 21830867
  35. Five novel SGLT2 mutations were identified in familial renal glucosuria patients. Mutant SGLT2 proteins had significantly lower glucose transport capacity upon reconstruction in cultured cells. PMID: 21165652
  36. SGLT2 plays an important role in renal tubular glucose reabsorption. PMID: 14569097
  37. homozygous missense mutation in exon 8 of SLC5A2, resulting in a lysine to arginine substitution at position 321 underlies autosomal-recessive renal glucosuria and aminoaciduria PMID: 15610225
  38. Thioglycoside I (phenyl-1'-thio-beta-D-glucopyranoside) inhibited hSGLT2. PMID: 17505558
  39. Within 17 pedigrees, we have identified a total of 20 different SLC5A2 mutations in familial renal glucosuria. PMID: 18622023

Show More

Hide All

Database Links

HGNC: 11037

OMIM: 182381

KEGG: hsa:6524

STRING: 9606.ENSP00000327943

UniGene: Hs.709195

Involvement In Disease
Renal glucosuria (GLYS)
Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SLC5A2 and what is its physiological role?

Sodium/glucose cotransporter 2 (SLC5A2), also known as SGLT2, is a critical membrane protein that functions as a low-affinity, high-capacity glucose transporter primarily expressed in the kidney. This protein plays a fundamental role in renal glucose reabsorption, with a sodium-to-glucose coupling ratio of 1:1 under physiological conditions. SLC5A2 is responsible for approximately 90% of filtered glucose reabsorption in the kidney, primarily in the early proximal convoluted tubule, especially the S1 segment .

The protein is encoded by the SLC5A2 gene located on chromosome 16p11.2 in humans. Functionally, SLC5A2 works in concert with other transporters, such as SLC5A1 (SGLT1), to facilitate efficient substrate transport in the mammalian kidney through a series arrangement along kidney proximal tubules .

What are the key structural characteristics of recombinant human SLC5A2?

Recombinant human SLC5A2 exhibits several important structural features:

CharacteristicDetails
Full-length protein672 amino acids
Partial recombinant formOften expression region 1-102aa
Amino acid sequence (partial)MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Molecular weight30.5-31.2 kDa (for tagged partial protein)
Common tagsN-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged or N-terminal His-IF2DI Tag
Transmembrane domains14 (in full-length protein)
Subcellular locationMembrane, multi-pass membrane protein

The recombinant form typically includes fusion tags to facilitate purification and detection, which may alter the molecular weight from the native protein .

What are the optimal storage conditions for recombinant SLC5A2?

For optimal stability and activity retention, researchers should follow these evidence-based storage protocols:

  • Short-term storage: -20°C

  • Long-term storage: -80°C

  • Lyophilized form: -20°C for up to 12 months

  • Reconstituted protein: 2-8°C for up to 1 month under sterile conditions

It is crucial to minimize freeze-thaw cycles as they can significantly impair protein activity. The recommended storage buffer typically consists of a Tris/PBS-based solution containing 5-50% glycerol. For lyophilized preparations, the buffer often includes Tris/PBS with 6% trehalose at pH 8.0 to enhance stability .

What is the recommended protocol for reconstituting lyophilized recombinant SLC5A2?

For optimal protein recovery and activity, follow this methodological approach:

  • Centrifuge the vial containing lyophilized protein at 10,000 rpm for 1 minute to ensure all material is at the bottom of the container

  • Reconstitute to a concentration of 200 μg/ml using sterile distilled water

  • Mix by gentle pipetting 2-3 times; avoid vortexing as this can denature the protein

  • Allow the solution to stand at room temperature for 10-15 minutes to ensure complete solubilization

  • If needed for experiments, dilute further with appropriate buffers

The diluent buffer composition typically contains 10 mM Hepes, 500 mM NaCl with 5% trehalose and 0.06% proclin, pH7.4, which helps maintain protein stability after reconstitution .

How can researchers verify the functionality of recombinant SLC5A2 in vitro?

Verifying the functionality of recombinant SLC5A2 requires multifaceted approaches:

  • Transport Activity Assays: Measure sodium-dependent glucose uptake in membrane vesicles or cells expressing the recombinant protein. The 1:1 sodium-to-glucose coupling ratio should be observable under physiological conditions .

  • Binding Assays: Assess the protein's ability to bind specific ligands, including glucose and sodium, using techniques such as surface plasmon resonance or isothermal titration calorimetry.

  • Inhibitor Response: Test the protein's response to known SGLT2 inhibitors, which should reduce transport activity in a dose-dependent manner.

  • Western Blotting: Confirm protein expression and integrity using SLC5A2-specific antibodies, with an expected band at approximately 30.5-31.2 kDa for the partial recombinant protein .

  • ELISA: Quantify protein levels and assess binding properties in solution-based assays .

Researchers should include appropriate positive and negative controls in all functional assays to ensure result validity.

How do genetic variants in SLC5A2 affect protein function and what are their clinical implications?

Genetic variants in SLC5A2 can significantly impact protein function with important clinical consequences:

Variant TypeFunctional EffectClinical Implication
Loss-of-function mutationsReduced or abolished glucose reabsorptionFamilial renal glucosuria (FRG)
Splice site variants (e.g., c.469-1G>A)Altered splicing affecting protein structureRenal glucosuria with variable severity
Heterozygous variantsPartially reduced cotransporter expressionPossible cardiovascular and renal protection

Recent research identified a novel heterozygous c.469-1G>A variant predicted to alter splicing with a SpliceAI delta score of 1.0. This variant was associated with overt glucosuria (23.3 g/1.73 m²/24 h), generalized aminoaciduria, and increased uric acid excretion in a patient with diabetes mellitus .

Interestingly, reduced expression of SGLT2 cotransporters due to genetic variants may provide cardiovascular and renal protection, similar to the effects observed with SGLT2 inhibitor medications. The mechanism involves increased sodium, chloride, and glucose outflow to distal nephron segments, activating tubuloglomerular feedback and leading to afferent arteriolar vasoconstriction, which reduces intraglomerular pressure .

What is the relationship between SLC5A2 function and estimated glomerular filtration rate (eGFR)?

Mendelian randomization studies have established a causal relationship between SLC5A2 and eGFR. Research reveals:

  • The SLC5A2 gene is causally associated with eGFR, with inhibition of SLC5A2 gene expression linked to higher eGFR values .

  • Using instrumental variable analysis, researchers found that SGLT2 inhibition (represented by SLC5A2 genetic variants) positively influences eGFR.

  • Specifically, a 1-SD increase in HbA1c regulated by SLC5A2 was associated with a decrease in eGFR (IVW β -0.038, 95% CI -0.061 to -0.015, P = 0.001 for multi-ancestry populations) .

  • The relationship is even stronger in European ancestry populations (IVW β -0.053, 95% CI -0.077 to -0.028, P = 2.45E-05) .

This genetic evidence aligns with clinical observations where SGLT2 inhibitors show renoprotective effects, suggesting that both pharmacological and genetic inhibition of SLC5A2 may preserve renal function.

How can researchers apply Mendelian randomization to study SLC5A2's causal relationships?

Mendelian randomization (MR) provides a powerful approach for investigating causal relationships between SLC5A2 and clinical outcomes. The methodology involves:

  • Selection of Instrumental Variables: Identify genetic variants that specifically affect SLC5A2 expression or function to serve as proxies for SGLT2 inhibition.

  • Outcome Selection: Choose clinically relevant endpoints such as eGFR, type 2 diabetes (T2DM), or cardiovascular outcomes.

  • Statistical Analysis: Apply methods such as inverse variance weighted (IVW), MR-Egger, and weighted median approaches to estimate causal effects.

  • Validation: Use positive controls (such as T2DM for SGLT2) to confirm method validity.

In a recent study utilizing this approach, researchers found that genetic variants in SLC5A2 showed a causal relationship with T2DM risk, with a 1-SD increase in HbA1c regulated by SLC5A2 associated with an 83% increase in T2DM risk (IVW OR 1.83, 95% CI: 1.180-2.846, p = 0.007) . This provided validation of the study design, as SGLT2 inhibitors are established glucose-lowering drugs.

The same study demonstrated that SLC5A2 variants were causally associated with eGFR, confirming the renoprotective mechanism suggested by clinical studies of SGLT2 inhibitors .

What are the challenges in studying structure-function relationships of SLC5A2?

Researchers face several methodological challenges when investigating SLC5A2 structure-function relationships:

  • Membrane Protein Crystallization: As a 14-transmembrane domain protein, SLC5A2 presents difficulties for conventional crystallization approaches, requiring specialized detergents and stabilization strategies.

  • Functional Expression: Maintaining proper folding and function in heterologous expression systems requires optimization of conditions to ensure physiologically relevant activity.

  • Partial versus Full-length Protein: While partial constructs (such as the 1-102aa fragment) are easier to express and purify, they lack the complete functional domains required for transport activity, necessitating careful experimental design and interpretation .

  • Post-translational Modifications: Native SLC5A2 undergoes various modifications that may be absent in recombinant systems, potentially affecting function and interactions.

  • Species Differences: Human SLC5A2 exhibits structural and functional differences from orthologs in model organisms, complicating translation of findings.

To address these challenges, researchers typically employ complementary approaches, including computational modeling, site-directed mutagenesis, chimeric proteins, and advanced imaging techniques such as cryo-electron microscopy.

How might SLC5A2 research inform development of next-generation renal and metabolic therapeutics?

The ongoing investigation of SLC5A2 structure, function, and genetic variation offers promising avenues for therapeutic innovation:

  • Personalized SGLT2 Inhibitor Therapy: Understanding how genetic variants in SLC5A2 affect response to inhibitors could enable tailored treatment approaches for diabetes and kidney disease. The discovery of variants like c.469-1G>A provides insights into natural inhibition models .

  • Novel Binding Site Targeting: Detailed structural studies of recombinant SLC5A2 may reveal previously uncharacterized binding sites that could be exploited for developing inhibitors with improved selectivity or efficacy.

  • Combination Therapy Approaches: Research on how SLC5A2 interacts with other transporters and signaling pathways could inform rational combination therapies that enhance cardiorenal protection.

  • Biomarker Development: The established causal relationship between SLC5A2 and eGFR suggests potential for developing biomarkers that predict response to SGLT2 inhibition .

  • Gene Therapy Applications: Understanding the beneficial effects of reduced SLC5A2 expression could potentially inform gene therapy approaches for chronic kidney disease.

Crucially, the integration of genetic data with functional studies of recombinant SLC5A2 provides a foundation for translational research that bridges basic science and clinical application, potentially revolutionizing approaches to managing diabetes and its complications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.