Recombinant Human Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
NKAIN4; C20orf58; FAM77A; Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4; Na(+/K(+-transporting ATPase subunit beta-1-interacting protein 4; Protein FAM77A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NKAIN4
Target Protein Sequence
MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLR YVMVYTLWAAVWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVP AVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDF IGGFDPFPLYHVNEKPSSLLSKQVYLPA
Uniprot No.

Target Background

Database Links

HGNC: 16191

OMIM: 612873

KEGG: hsa:128414

STRING: 9606.ENSP00000359340

UniGene: Hs.46627

Protein Families
NKAIN family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NKAIN4 and what is its primary biological function?

NKAIN4 (Na+/K+ Transporting ATPase Interacting 4) is a protein-coding gene that produces a transmembrane protein which interacts with the β1 subunit of Na+/K+ transporting ATPase (sodium-potassium pump) . The primary function of NKAIN4 appears to be modulating the activity of the sodium-potassium pump, which is crucial for maintaining cellular electrochemical gradients by removing 3 Na+ ions from the cell while transporting 2 K+ ions into the cell through ATP hydrolysis . This interaction is fundamental for cells to maintain osmotic pressure and establish proper electrochemical gradients necessary for cellular functions .

In recent research, NKAIN4 has been identified as having potential roles beyond simple pump interaction, including possible involvement in immune regulation and cancer progression, particularly in colon adenocarcinoma (COAD) .

How is NKAIN4 gene expression regulated in normal and pathological states?

Regulatory mechanisms may involve genomic alterations, as studies have found significant co-occurrence of NKAIN4 alterations with immune checkpoint genes such as OBSCN, MUC16, and MUC17 in colon cancer . This suggests potential co-regulation or functional relationships between NKAIN4 and these immune-related factors.

Experimental research aimed at elucidating the regulatory mechanisms would typically involve promoter analysis, transcription factor binding studies, and epigenetic profiling of the NKAIN4 gene locus under various physiological and pathological conditions.

What role does NKAIN4 play in cancer progression and lymph node metastasis?

NKAIN4 has emerged as a significant factor in cancer progression, particularly in colon adenocarcinoma (COAD) with lymph node metastasis. Research has identified NKAIN4 as one of five genes (along with PMCH, CD1B, NAT1, and LRP2) incorporated into a prognostic signature for COAD patients . This signature was constructed based on differentially expressed genes between patients with lymph node metastasis (N+ group) and those without (N0 group) .

The mechanism through which NKAIN4 promotes cancer progression may be related to its role in enhancing sodium-potassium pump activity. Research suggests that in COAD, NKAIN4 might promote tumor proliferation and progression by activating the expression of the sodium-potassium pump's β1 subunit, thereby enhancing pump activity and function . The sodium-potassium pump has been found to play crucial roles in cell growth, differentiation, survival, metastasis, and invasion in various tumors .

Experimental evidence indicates that sodium-potassium pump activity is enhanced in multiple tumors, with increased expression of its subunits in lung cancer, kidney cancer, colorectal cancer, medulloblastoma, cervical cancer, and other malignancies . This suggests that NKAIN4, as a regulator of this pump, could be a critical factor in the molecular pathogenesis of these cancers.

How does NKAIN4 interact with the immune system, particularly in the context of T follicular helper cells?

NKAIN4 appears to have intriguing relationships with the immune system, particularly with T follicular helper (Tfh) cells in the context of colon adenocarcinoma. Correlation analysis has revealed a statistically significant, albeit moderate, positive correlation (R=0.23, P<0.05) between NKAIN4 expression and Tfh cell infiltration in COAD tissues .

This relationship is particularly notable in tissues with lymph node metastasis, which show increased infiltration of Tfh cells. The correlation suggests potential regulatory interactions between NKAIN4 and Tfh cells, potentially contributing to the immune tolerance observed in metastatic environments .

Further supporting this immune regulatory role, genomic investigations have revealed that NKAIN4 alterations show statistically significant co-occurrence with extensive immune checkpoints such as OBSCN, MUC16, and MUC17 . This strongly indicates that NKAIN4 may function as a coregulator of immune checkpoints in COAD, potentially influencing the tumor immune microenvironment and contributing to immune evasion mechanisms .

What are the potential mechanisms through which NKAIN4 regulates sodium-potassium pump activity?

The mechanisms through which NKAIN4 regulates the sodium-potassium pump activity likely involve direct protein-protein interactions with the pump's β1 subunit, as suggested by its name (Na+/K+ Transporting ATPase Interacting 4) . This interaction may modulate the assembly, stability, trafficking, or catalytic activity of the sodium-potassium pump.

The sodium-potassium pump functions by hydrolyzing ATP to transport ions against their concentration gradients, removing 3 Na+ ions from the cell while importing 2 K+ ions . This activity is essential for maintaining cellular electrochemical gradients. Beyond this primary function, the pump also acts as a scaffolding protein for various molecular interactions and as a signal transduction molecule influencing cell growth, differentiation, and survival .

Based on research in colon adenocarcinoma, it is hypothesized that NKAIN4 may enhance pump activity by activating the expression of the β1 subunit, thereby promoting tumor proliferation and progression . This mechanism would explain the association between elevated NKAIN4 expression and adverse cancer outcomes.

Experimental approaches to further elucidate these mechanisms might include:

  • Co-immunoprecipitation studies to confirm direct interactions

  • Mutational analyses to identify critical interaction domains

  • Enzyme kinetic assays to measure the effect of NKAIN4 on pump activity

  • Cellular localization studies to track the influence of NKAIN4 on pump trafficking

How can genomic alterations of NKAIN4 influence its function in disease contexts?

Genomic investigations have revealed important patterns of NKAIN4 alterations in disease contexts, particularly in colon adenocarcinoma. NKAIN4 alterations show statistically significant co-occurrence with multiple immune checkpoint genes, including OBSCN, MUC16, and MUC17 . This pattern suggests potential functional relationships or co-regulatory mechanisms between NKAIN4 and these immune-related factors.

The types of alterations observed in NKAIN4 may include fusion, amplification, deep deletion, truncating mutations, and missense mutations . These alterations could potentially modify the protein's interaction with the sodium-potassium pump, affect its expression levels, or alter its participation in signaling pathways.

In the context of lymph node metastasis in colon cancer, NKAIN4 has been identified as part of a five-gene prognostic signature . This suggests that alterations in NKAIN4 expression or function may contribute to the metastatic potential of cancer cells, possibly through mechanisms involving the sodium-potassium pump activity and immune system interactions.

Understanding how these genomic alterations influence NKAIN4 function requires comprehensive approaches including:

  • Correlation of specific alteration types with clinical outcomes

  • Functional studies of mutant NKAIN4 proteins

  • Analysis of downstream pathway effects triggered by altered NKAIN4

  • Investigation of compensatory mechanisms in cells with NKAIN4 alterations

What are the optimal methods for expressing and purifying recombinant NKAIN4 protein for research applications?

Expressing and purifying recombinant NKAIN4 protein presents several challenges due to its transmembrane nature. Based on available information, the following methodology has proven effective:

Expression Systems:

  • HEK-293 cells have been successfully used for expression of human NKAIN4 (AA 1-208)

  • Cell-free protein synthesis (CFPS) systems are also viable alternatives for both human and mouse NKAIN4

Expression Vectors:

  • pcDNA3.1-C-(k)DYK is a standard vector used for NKAIN4 expression

  • Custom vectors can be employed based on specific experimental requirements

Purification Strategy:

  • Affinity tags: C-terminal DYKDDDDK (FLAG) tags or His tags facilitate purification

  • Strep-tag can be used as an alternative affinity tag

  • Seamless cloning technology (CloneEZTM) is recommended for insert preparation

Purification Assessment:

  • Purity evaluation typically achieves >70-80% as determined by:

    • SDS-PAGE

    • Western Blot

    • Analytical SEC (HPLC)

Storage Conditions:

  • Store purified protein at -80°C

  • Avoid repeated freeze-thaw cycles to maintain protein integrity

This methodology has been validated for producing functional NKAIN4 protein suitable for various applications including ELISA, SDS analysis, and Western blotting .

What experimental approaches are most effective for studying NKAIN4 interactions with the sodium-potassium pump?

Investigating the interactions between NKAIN4 and the sodium-potassium pump requires sophisticated approaches that preserve the native confirmation of these membrane proteins. Based on current research methodologies, the following approaches are recommended:

Co-immunoprecipitation (Co-IP):

  • Use antibodies against NKAIN4 or the β1 subunit of Na+/K+-ATPase

  • Employ mild detergents (e.g., digitonin, CHAPS) to preserve membrane protein interactions

  • Validate interactions using reciprocal Co-IP experiments

Proximity Ligation Assay (PLA):

  • Enables visualization of protein interactions in situ

  • Provides spatial information about where in the cell these interactions occur

  • Particularly valuable for confirming interactions in their native cellular context

Fluorescence Resonance Energy Transfer (FRET):

  • Tag NKAIN4 and Na+/K+-ATPase subunits with appropriate fluorophores

  • Measure energy transfer as evidence of close proximity

  • Can be performed in living cells to capture dynamic interactions

Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI):

  • Measure binding kinetics between purified NKAIN4 and Na+/K+-ATPase subunits

  • Determine association and dissociation constants

  • Identify the regions important for interaction using truncated proteins

Functional Assays:

  • Measure Na+/K+-ATPase activity in the presence and absence of NKAIN4

  • Use radioactive rubidium (86Rb+) uptake assays to measure pump function

  • Employ patch-clamp electrophysiology to measure pump-mediated currents

Structural Studies:

  • Cryo-electron microscopy of the NKAIN4-pump complex

  • X-ray crystallography of interacting domains

  • NMR studies of binding interfaces using isotopically labeled proteins

These methodologies should be complemented with appropriate controls and validation experiments to ensure the specificity and physiological relevance of observed interactions.

How can researchers effectively analyze NKAIN4 expression patterns in patient samples for clinical correlation studies?

Analyzing NKAIN4 expression in patient samples requires robust methodologies that can be applied to clinical specimens. Based on successful approaches in colon adenocarcinoma research, the following methods are recommended:

RNA Analysis:

  • RNA Extraction and Quality Control:

    • Use specialized kits designed for FFPE or fresh-frozen tissue samples

    • Assess RNA integrity using Bioanalyzer or similar platforms

    • Implement strict quality control thresholds (RIN >7 recommended)

  • Gene Expression Quantification:

    • RT-qPCR with validated NKAIN4-specific primers

    • RNA-seq for genome-wide contextual analysis

    • NanoString technology for direct counting without amplification

Protein Analysis:

  • Immunohistochemistry (IHC):

    • Use validated antibodies against NKAIN4

    • Employ automated staining platforms for consistency

    • Implement digital pathology quantification for objective scoring

  • Western Blotting:

    • Use tissue lysates with appropriate membrane protein extraction protocols

    • Include positive controls (recombinant NKAIN4 protein)

    • Quantify relative to housekeeping proteins

Data Analysis Framework:

  • Expression Correlation:

    • Compare NKAIN4 expression with clinical parameters

    • Analyze correlation with immune cell infiltration using algorithms like CIBERSORT

    • Perform multivariate analysis to control for confounding factors

  • Survival Analysis:

    • Kaplan-Meier plotting based on NKAIN4 expression levels

    • Cox proportional hazards modeling to establish prognostic value

    • Time-dependent ROC analysis to determine optimal cutoff values

Validation Approaches:

  • Independent cohort validation

  • Cross-platform confirmation (e.g., validating RNA findings at protein level)

  • Spatial transcriptomics or single-cell analyses for cellular context

In colon adenocarcinoma research, NKAIN4 expression analysis has been successfully correlated with lymph node metastasis status and T follicular helper cell infiltration (correlation coefficient R=0.23, P<0.05) . This suggests that applying these methodologies can yield clinically meaningful information about the role of NKAIN4 in disease progression.

What CRISPR-Cas9 strategies are most appropriate for investigating NKAIN4 function in cellular models?

CRISPR-Cas9 technology offers powerful approaches for investigating NKAIN4 function through precise genetic manipulation. For transmembrane proteins like NKAIN4, the following specialized strategies are recommended:

Knockout Strategies:

  • Complete Gene Knockout:

    • Design multiple sgRNAs targeting early exons of NKAIN4

    • Use paired sgRNAs to create large deletions spanning critical exons

    • Verify knockout by sequencing, RT-qPCR, and Western blotting

  • Conditional Knockout:

    • Implement floxed alleles with Cre recombinase systems

    • Use inducible promoters (e.g., Tet-On/Off) for temporal control

    • Particularly valuable for studying time-dependent processes

Knockin/Tagging Approaches:

  • Endogenous Tagging:

    • Insert fluorescent proteins (e.g., GFP, mCherry) at the C-terminus

    • Add affinity tags (FLAG, HA, His) for purification/detection

    • Include flexible linkers to minimize functional interference

  • Domain-Specific Mutations:

    • Introduce point mutations in putative functional domains

    • Target regions implicated in Na+/K+-ATPase interaction

    • Create truncation variants to map interaction domains

Transcriptional Modulation:

  • CRISPRa (Activation):

    • Target NKAIN4 promoter with dCas9-VP64 or similar activators

    • Use multiple sgRNAs for synergistic activation

    • Create models with controlled overexpression

  • CRISPRi (Interference):

    • Use dCas9-KRAB to repress NKAIN4 expression

    • Alternative to knockout for dose-dependent studies

    • Useful for studying partial loss-of-function phenotypes

Delivery Considerations:

  • For hard-to-transfect cells, use lentiviral or AAV delivery systems

  • Consider cell type-specific promoters for targeted expression

  • Implement antibiotic selection or fluorescent markers for isolation

Validation and Functional Assessment:

  • Confirm editing efficiency using NGS or T7E1 assays

  • Assess Na+/K+-ATPase activity in edited cells

  • Evaluate phenotypic changes relevant to cancer progression or immune interactions

  • Perform rescue experiments with wildtype NKAIN4 to confirm specificity

These CRISPR-based approaches provide a comprehensive toolkit for dissecting NKAIN4 function in various cellular contexts, particularly in relation to sodium-potassium pump regulation and immune cell interactions.

How might NKAIN4 be exploited as a therapeutic target for cancer treatment?

Given its role in cancer progression and lymph node metastasis, NKAIN4 presents a promising therapeutic target. Several strategic approaches could be explored:

Direct Inhibition Strategies:

  • Development of small molecule inhibitors targeting the interaction between NKAIN4 and the Na+/K+-ATPase β1 subunit

  • Peptide-based inhibitors mimicking key interaction domains

  • Antibody-based therapeutics that could neutralize NKAIN4 function

Immunotherapeutic Approaches:

  • Given NKAIN4's correlation with T follicular helper cells and co-occurrence with immune checkpoint alterations, combination therapies with established immune checkpoint inhibitors could be synergistic

  • Development of CAR-T cells targeting NKAIN4-expressing cancer cells

  • Vaccine approaches to generate immune responses against NKAIN4-expressing cells

Gene Therapy Approaches:

  • CRISPR-based targeting of NKAIN4 in tumor cells

  • siRNA/shRNA delivery systems for localized NKAIN4 knockdown

  • Antisense oligonucleotides targeting NKAIN4 mRNA

The development of NKAIN4-targeted therapies would require careful validation in preclinical models, particularly focusing on the effects on lymph node metastasis in colorectal cancer models, given the established role of NKAIN4 in this context .

What are the most promising biomarker applications for NKAIN4 in clinical oncology?

NKAIN4 shows significant potential as a biomarker in clinical oncology, with several promising applications:

Prognostic Biomarker:

  • NKAIN4 has been incorporated into a five-gene prognostic signature (along with PMCH, CD1B, NAT1, and LRP2) for predicting outcomes in colon adenocarcinoma patients

  • Expression levels could be used to stratify patients into risk categories for recurrence or metastasis

Predictive Biomarker for Lymph Node Metastasis:

  • NKAIN4 expression may predict the likelihood of lymph node metastasis in colorectal cancer patients

  • This could inform surgical decision-making regarding lymph node dissection extent

Companion Diagnostic:

  • If NKAIN4-targeted therapies are developed, expression testing would be essential to identify patients likely to respond

  • Could be integrated into multi-marker panels to improve predictive accuracy

Immune Response Predictor:

  • Given its correlation with T follicular helper cell infiltration, NKAIN4 might predict response to immunotherapies

  • Could help identify patients who would benefit from specific immune checkpoint inhibitors

Implementation Approaches:

  • RNA-based testing using RT-qPCR or NanoString technology from tissue biopsies

  • Immunohistochemistry-based protein detection in pathology specimens

  • Potential for development of liquid biopsy approaches (circulating tumor DNA or exosomes)

The clinical utility of NKAIN4 as a biomarker would need to be validated in large, prospective clinical trials before implementation in standard clinical practice. Integration with other established biomarkers could enhance its predictive and prognostic value.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.