Recombinant Human Sodium/potassium-transporting ATPase subunit beta-3 (ATP1B3)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Sodium/potassium-transporting ATPase subunit beta-3 (ATP1B3) represents one of the beta subunits of the Na+/K+-ATPase complex, a fundamental enzyme responsible for maintaining electrochemical gradients across cellular membranes . The human ATP1B3 protein consists of 279 amino acids and functions as a regulatory component that associates with catalytic alpha subunits to form the complete and functional Na+/K+-ATPase enzyme complex . As a recombinant protein, ATP1B3 is produced through various expression systems and is available commercially for research applications with different tags and specifications .

Molecular Structure and Protein Characteristics

ATP1B3 contains multiple functional domains that contribute to its specific interactions with other proteins and its role in the Na+/K+-ATPase complex. The protein undergoes post-translational modifications, particularly glycosylation, which appears to be critical for its proper localization and function . Commercial recombinant versions often include specific segments of the full-length protein, such as amino acids 61-273, which contain key functional domains while excluding signal peptides or transmembrane regions that might complicate expression and purification .

Expression Systems and Production Methods

Recombinant ATP1B3 is produced using several expression systems, each offering distinct advantages for research applications. The most common expression platforms include:

  1. Prokaryotic systems (Escherichia coli): Provide high yield but lack post-translational modifications like glycosylation

  2. Eukaryotic systems (HEK-293 cells): Offer proper protein folding and post-translational modifications similar to native human proteins

  3. Cell-free systems (Wheat germ): Allow expression of proteins that might be toxic to host cells

Purification and Quality Control

Recombinant ATP1B3 proteins undergo rigorous purification processes, typically utilizing affinity chromatography based on fusion tags such as polyhistidine (His) or glutathione S-transferase (GST) . Quality control measures include SDS-PAGE analysis for purity assessment, with commercial products often exceeding 90-97% purity . These high-purity preparations are essential for reliable experimental results and applications in immunological studies, protein-protein interaction analyses, and functional assays.

Role in Enzyme Complex Assembly

ATP1B3 serves as a critical regulatory component of the Na+/K+-ATPase complex, mediating the proper assembly and trafficking of the complete enzyme . Research has demonstrated that ATP1B3 specifically interacts with the alpha-1 subunit of Na+/K+-ATPase, which constitutes the major catalytic component of the functional complex . This interaction is essential for stabilizing the alpha subunit and facilitating its transport from the endoplasmic reticulum to the plasma membrane.

Impact on Enzyme Activity and Regulation

The beta-3 subunit influences both the catalytic activity and regulatory properties of the Na+/K+-ATPase complex. Studies investigating the activity of Na+/K+-ATPase in relation to ATP1B3 have shown that alterations in ATP1B3 expression or processing directly affect the enzyme's ability to transport ions across cellular membranes . These findings highlight the crucial role of ATP1B3 in maintaining cellular ion homeostasis and membrane potential.

Tissue-Specific Expression and Function

While the search results do not provide comprehensive information about ATP1B3's tissue-specific expression patterns, the protein has been identified in brain microvascular endothelial cells, suggesting an important role in the central nervous system and blood-brain barrier function . The specific distribution of ATP1B3 across different tissues and cell types likely contributes to specialized functions of the Na+/K+-ATPase complex in various physiological contexts.

Interaction with Enterovirus 71

Research has identified a novel interaction between ATP1B3 and the 3A protein of Enterovirus 71 (EV71), a pathogen associated with hand, foot, and mouth disease and neurological complications . This interaction was initially discovered through yeast two-hybrid assays and subsequently confirmed through multiple experimental approaches including immunofluorescent co-localization analysis and co-immunoprecipitation studies . Interestingly, confocal microscopic analysis revealed that the 3A fusion protein co-localizes with ATP1B3 on the membrane of infected cells, suggesting a functional relationship during viral infection .

Antiviral Effects and Mechanisms

ATP1B3 exhibits significant antiviral properties against EV71 infection. Studies have demonstrated that:

  1. EV71 infection increases ATP1B3 expression in infected cells at both mRNA and protein levels

  2. ATP1B3 expression levels positively correlate with infection time and viral dose

  3. Knockdown of ATP1B3 using siRNA significantly enhances EV71 replication

  4. Overexpression of ATP1B3 substantially suppresses viral replication

These findings establish ATP1B3 as a virus-induced host factor that paradoxically inhibits viral proliferation, suggesting an important role in cellular antiviral defense mechanisms .

Regulation of Type I Interferon Response

The mechanism underlying ATP1B3's antiviral activity appears to involve the stimulation of type I interferon (IFN) production . Experimental data shows that:

  1. ATP1B3 knockdown significantly decreases intracellular levels of IFN-α/β mRNA

  2. ATP1B3 overexpression substantially increases IFN-α/β mRNA levels

  3. Neutralization of type I interferons using specific antibodies reverses the ATP1B3-mediated inhibition of viral growth

Table 2: ATP1B3 Effects on Viral Infection and Immune Response

Experimental ConditionEffect on EV71 ReplicationEffect on Type I IFN ProductionReference
ATP1B3 KnockdownSignificantly increasedDecreased
ATP1B3 OverexpressionSignificantly decreasedIncreased
Anti-IFN-α/β Antibodies + ATP1B3 OverexpressionRestored viral growthNeutralized
EV71 Infection Time CoursePositive correlation with ATP1B3 expressionNot specified

These results establish ATP1B3 as a potential therapeutic target for enhancing antiviral immunity, particularly against EV71 infection .

Interaction with CASPR1

Recent research has identified a significant interaction between ATP1B3 and Contactin-associated protein 1 (CASPR1 or CNTNAP1) in brain microvascular endothelial cells (BMECs), which are the primary cellular component of the blood-brain barrier . This interaction was discovered through yeast two-hybrid screening using CASPR1 as bait, followed by validation using multiple complementary approaches including GST-pulldown, immunofluorescence, and co-immunoprecipitation assays .

Notably, only the core proteins of ATP1B3, not its glycosylated forms, interact with CASPR1, with this interaction primarily occurring in the endoplasmic reticulum of BMECs . This specificity suggests a selective mechanism involving early-stage processing of ATP1B3 before its full maturation and trafficking to the plasma membrane.

Regulation of Na+/K+-ATPase Maturation and Trafficking

The CASPR1-ATP1B3 interaction plays a critical role in regulating Na+/K+-ATPase maturation and membrane localization . Experimental evidence demonstrates that:

  1. CASPR1 knockdown reduces ATP1B3 glycosylation, a critical post-translational modification

  2. CASPR1 depletion prevents ATP1B3 localization to the plasma membrane

  3. These effects can be reversed by expression of full-length CASPR1

  4. CASPR1 knockdown reduces plasma membrane distribution of the alpha-1 subunit of Na+/K+-ATPase

These findings establish CASPR1 as an important regulator of ATP1B3 processing and, consequently, Na+/K+-ATPase assembly and function .

Impact on Glutamate Transport and CNS Homeostasis

The functional significance of the CASPR1-ATP1B3 interaction extends to glutamate transport across the blood-brain barrier, a process crucial for central nervous system homeostasis . Research has shown that:

  1. CASPR1 silencing using shRNA reduces glutamate efflux through BMECs

  2. Na+/K+-ATPase activity is diminished in CASPR1-silenced BMECs

  3. CASPR1 binds with ATP1B3 but not with the alpha-1 subunit, suggesting a specific role in facilitating Na+/K+-ATPase assembly

These results highlight the importance of CASPR1-mediated regulation of ATP1B3 and Na+/K+-ATPase function in maintaining the specialized properties of the blood-brain barrier and regulating neurotransmitter levels in the central nervous system .

Research Applications

Recombinant ATP1B3 serves various research purposes, including:

  1. Protein-protein interaction studies to identify novel binding partners and cellular pathways

  2. Functional assays to assess Na+/K+-ATPase activity under different experimental conditions

  3. Immunological studies as antigens for antibody production and validation

  4. Structural analyses to elucidate the three-dimensional organization of Na+/K+-ATPase complexes

Potential Therapeutic Applications

The emerging understanding of ATP1B3's roles in viral immunity and blood-brain barrier function suggests several promising therapeutic applications:

  1. Antiviral strategies: Enhancing ATP1B3 expression or activity could potentially boost innate immunity against EV71 and possibly other viral infections

  2. Blood-brain barrier modulation: Targeting the CASPR1-ATP1B3 interaction might allow for controlled regulation of blood-brain barrier permeability in conditions requiring enhanced drug delivery to the central nervous system

  3. Neuroprotective approaches: Maintaining proper ATP1B3 function could help preserve blood-brain barrier integrity and glutamate homeostasis in neurological disorders

Diagnostic Potential

Given its specific interactions and regulatory functions, ATP1B3 might serve as a biomarker for certain pathological conditions, particularly those involving:

  1. Viral infections where ATP1B3 expression changes correlate with disease progression

  2. Blood-brain barrier dysfunction in neurological disorders

  3. Ion transport abnormalities in various tissues

Expanded Protein Interaction Networks

While interactions with EV71 3A protein and CASPR1 have been identified, ATP1B3 likely participates in additional protein-protein interactions that contribute to its diverse biological functions. Comprehensive interactome studies using advanced proteomics approaches would help uncover these networks and potentially identify new therapeutic targets.

Therapeutic Development

The antiviral properties of ATP1B3 and its role in blood-brain barrier function warrant further investigation for therapeutic development. Potential approaches include:

  1. Small molecule modulators of ATP1B3 function or expression

  2. Peptide-based therapeutics targeting specific protein-protein interactions

  3. Gene therapy approaches to regulate ATP1B3 expression in specific tissues

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ATP1B3; Sodium/potassium-transporting ATPase subunit beta-3; Sodium/potassium-dependent ATPase subunit beta-3; ATPB-3; CD antigen CD298
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Uniprot No.

Target Background

Function
This protein represents the non-catalytic component of the active enzyme, which facilitates the hydrolysis of ATP in conjunction with the exchange of Na(+) and K(+) ions across the plasma membrane. The precise function of the beta-3 subunit remains unclear.
Gene References Into Functions
  1. Ligation of the Na, K ATPase beta3 subunit on monocytes by mAb P-3E10 mediates T cell hypofunction. This antibody has potential as a novel immunotherapeutic agent for treating hyperresponsive T cell-associated diseases. PMID: 29940031
  2. Our research indicated that ATP1B3 inhibits EV71 replication by enhancing the production of type-I interferons, suggesting its potential as a therapeutic target in EV71 infections. PMID: 27240146
  3. Data suggest that ATP1B3 interacts with BST-2 and regulates its stability. ATP1B3 acts as a co-factor that accelerates BST-2 degradation, leading to reduced BST-2-mediated restriction of HIV-1 replication/tropism and NFkappaB activation. PMID: 26694617
  4. B7H3 and ATP1B3 are overexpressed in tumor endothelial cells, promoting an angiogenic phenotype. PMID: 24236063
  5. Plays a role in T and B lymphocyte activation. PMID: 12456588
  6. Our findings demonstrate that the beta3 subunit of Na, K ATPase is expressed on RBC membranes, although the epitope recognized by mAb P-3E10 is concealed in normal RBCs. We also observed the association of the beta3 subunit with the alpha subunit of Na, K ATPase. PMID: 17176442
Database Links

HGNC: 806

OMIM: 601867

KEGG: hsa:483

STRING: 9606.ENSP00000286371

UniGene: Hs.477789

Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Apical cell membrane; Single-pass type II membrane protein. Basolateral cell membrane; Single-pass type II membrane protein. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Q&A

What is the expression pattern of ATP1B3 in different grades of glioma?

ATP1B3 expression shows a strong positive correlation with glioma malignancy grade. Analysis of the CGGA (Chinese Glioma Genome Atlas) database reveals that ATP1B3 expression increases significantly with higher glioma grades (grades 2, 3, and 4), with statistically significant differences (P<0.001) . Immunohistochemical studies confirm this pattern, with grade 2 gliomas showing pale yellow staining (+), grade 3 exhibiting yellowish-brown staining (++), and grade 4 displaying brown staining (+++) . This graduated expression pattern suggests that ATP1B3 plays an important role in glioma progression and could serve as a potential biomarker for glioma grading and diagnosis .

How does ATP1B3 expression compare between glioma cell lines and normal cells?

Studies comparing glioma cell lines (U87MG and U251MG) with normal microglial cells (HMC3) demonstrate significantly elevated ATP1B3 expression in glioma cells . Western blot analyses confirm that glioma cells express substantially higher levels of ATP1B3 protein compared to normal controls (P<0.05) . This differential expression provides evidence that ATP1B3 upregulation is a characteristic feature of glioma cells rather than a general cellular phenomenon, suggesting its potential utility as a diagnostic marker and therapeutic target in glioma research .

What is the relationship between ATP1B3 expression and patient prognosis in gliomas?

Survival analyses based on TCGA (The Cancer Genome Atlas) data from 704 glioma patients reveal a significant negative correlation between ATP1B3 expression and patient survival . Patients with low ATP1B3 expression demonstrate notably higher survival rates compared to those with high expression (P<0.001) . This inverse relationship between ATP1B3 expression and patient prognosis suggests that ATP1B3 serves as a prognostic indicator in gliomas. The data aligns with current research findings, which consistently identify ATP1B3 as an oncogene associated with poor clinical outcomes .

How does ATP1B3 knockdown affect the malignant phenotype of glioma cells?

ATP1B3 knockdown induces significant changes in glioma cell behavior across multiple parameters. When ATP1B3 expression is inhibited through RNA interference (specifically using si-ATP1B3-336), both U87MG and U251MG glioma cells exhibit:

  • Reduced proliferation: CCK-8 cell proliferation assays show significantly decreased absorbance values in ATP1B3 knockdown cells compared to control groups (P<0.01)

  • Impaired migration: Transwell migration assays demonstrate substantially fewer migrating cells in the knockdown groups compared to controls (P<0.01 for U87MG; P<0.0001 for U251MG)

  • Decreased invasion capacity: Invasion assays reveal significantly reduced numbers of invading cells following ATP1B3 knockdown (P<0.01 for U87MG; P<0.001 for U251MG)

These consistent phenotypic changes across different experimental approaches confirm that ATP1B3 plays a crucial role in promoting glioma cell proliferation, migration, and invasion - the fundamental processes driving tumor progression .

Through which signaling pathways does ATP1B3 mediate its effects in glioma cells?

ATP1B3 appears to exert its pro-oncogenic effects through dual regulation of both MAPK and NF-κB signaling pathways . Experimental evidence indicates that ATP1B3 knockdown results in:

  • Reduced phosphorylation of MAPK pathway components: Following ATP1B3 deletion, there are statistically significant decreases in phosphorylation levels of:

    • p-Raf1

    • p-MEK 1/2

    • p-ERK 1/2

  • Decreased activation of NF-κB pathway molecules: ATP1B3 knockdown leads to reduced phosphorylation of:

    • p-IκBα

    • p-P65

  • Downregulation of downstream effectors: ATP1B3 silencing causes significant reduction in expression levels of:

    • Cyclin D1 (proliferation regulator)

    • VEGFA (angiogenesis inducer)

This molecular evidence suggests that ATP1B3 functions as an upstream regulator of both MAPK and NF-κB signaling cascades, which are well-established drivers of malignant phenotypes in gliomas .

What are the validated methods for efficient ATP1B3 knockdown in glioma cells?

Based on experimental validation, researchers have identified effective siRNA sequences for ATP1B3 knockdown in glioma cells:

  • Optimal siRNA sequence: si-ATP1B3-336 demonstrates the most pronounced knockdown effect among tested constructs (compared to si-ATP1B3-530 and si-ATP1B3-976)

  • Validation metrics:

    • RT-qPCR confirms significant reduction in ATP1B3 mRNA levels with si-ATP1B3-336 (P<0.0001)

    • Western blot analysis verifies substantial decrease in ATP1B3 protein expression with si-ATP1B3-336 (P<0.0001)

  • Transfection protocol:

    • Target glioma cell lines: U87MG and U251MG

    • Knockdown verification timeline: 48-72 hours post-transfection

    • Controls: si-NC (negative control siRNA)

This validated approach provides researchers with a reliable method for investigating ATP1B3 function through loss-of-function studies in glioma models .

How can researchers effectively measure ATP1B3-mediated effects on glioma cell proliferation?

The following methodological approach has been validated for assessing ATP1B3's impact on glioma cell proliferation:

  • CCK-8 cell proliferation assay:

    • Plate 3×10³ cells/well in 96-well plates with five replicates per experimental group

    • Add 10 μL of CCK-8 solution to each well following reagent instructions

    • Incubate for 1 hour at 37°C

    • Measure optical density (OD) at 450 nm using a microplate reader

    • Record values at 0, 24, 48, and 72 hours post-treatment

    • Compare OD values between control and ATP1B3-knockdown groups

  • Data interpretation:

    • Higher OD values indicate increased cell proliferation

    • Statistical significance is typically established at P<0.01 or P<0.001

    • Graphical representation typically plots time (hours) versus absorbance

This standardized approach enables reliable quantification of ATP1B3's effects on glioma cell proliferation dynamics over time .

What methods are recommended for assessing ATP1B3's impact on glioma cell invasion?

Researchers investigating ATP1B3's role in glioma invasion can employ the following validated experimental approach:

  • Transwell invasion assay protocol:

    • Upper chamber: Add 200μL of cell suspension in serum-free medium

    • Lower chamber: Add approximately 600μL of medium containing 10% fetal bovine serum

    • Incubation period: 24 hours at 37°C

    • Post-incubation processing: Fix basal cells with 4% formaldehyde and stain with Giemsa

    • Analysis: Count cells in five randomly selected fields under microscopic examination

  • Sample preparation recommendations:

    • Cell lines: U87MG and U251MG with ATP1B3 knockdown and control groups

    • Cell density: Standardized concentration of cells for consistent results

    • Matrigel coating: Required for invasion assessment (versus migration)

  • Quantification approach:

    • Count invading cells per high-power field

    • Calculate mean values from multiple fields

    • Apply statistical analysis to determine significance (typically P<0.01 or P<0.001)

This methodology provides researchers with a standardized approach to quantitatively assess how ATP1B3 modulation affects the invasive capacity of glioma cells .

How should researchers interpret changes in signaling pathway activation following ATP1B3 manipulation?

When analyzing signaling pathway changes after ATP1B3 knockdown or overexpression, researchers should follow these interpretive guidelines:

  • Phosphorylation status assessment:

    • Evaluate both total and phosphorylated forms of key signaling molecules

    • Calculate phosphorylated/total protein ratios to normalize for expression differences

    • Focus on relative changes in phosphorylation rather than absolute values

  • Pathway-specific considerations:

    • MAPK pathway: Analyze sequential activation (p-Raf1 → p-MEK1/2 → p-ERK1/2)

    • NF-κB pathway: Assess both p-IκBα (cytoplasmic inhibitor) and p-P65 (nuclear effector)

    • Consider pathway crosstalk, as ATP1B3 influences both cascades simultaneously

  • Temporal dynamics:

    • Evaluate early (minutes to hours) versus late (hours to days) signaling events

    • Consider feedback regulation mechanisms that may modulate initial signaling responses

    • Correlate signaling changes with functional outcomes (proliferation, migration, invasion)

These analytical approaches help researchers establish causality between ATP1B3-mediated signaling alterations and functional phenotypes in glioma cells .

What are the potential mechanisms explaining ATP1B3's role beyond its canonical ion transport function?

ATP1B3, beyond its classical role in Na⁺/K⁺-ATPase function, appears to exhibit non-canonical activities through several potential mechanisms:

  • Signaling platform functions:

    • The glycosylation portion of the β1 subunit's extracellular n-junction located in cell junction regions links to ERK1/2 activation

    • ATP1B3 may function as a scaffolding protein that facilitates the assembly of signaling complexes independent of ion transport

  • Immune modulatory activities:

    • ATP1B3 acts as a receptor molecule regulating immune cells

    • It inhibits T cell proliferation, potentially contributing to immunosuppressive tumor microenvironments

    • It assists in tumor tissue angiogenesis, promoting vascular development

  • Cell-specific expression patterns:

    • Among the three β subunits (β1, β2, β3) of Na⁺/K⁺-ATPase expressed in brain tissues:

      • β1 is expressed in all cells except astrocytes

      • β2 and β3 show variable expression patterns

      • β3 expression abnormally increases with disease severity while β2 expression decreases

  • Protein interaction networks:

    • ATP1B3 physically associates with CASPR1 in brain endothelial cells

    • This interaction specifically involves core (non-glycosylated) ATP1B3 proteins

    • Such protein-protein interactions may enable ATP1B3 to influence cellular functions beyond ion homeostasis

These diverse mechanisms help explain how ATP1B3 contributes to disease progression through multiple biological processes beyond simple ion transport .

What are the key unanswered questions regarding ATP1B3's role in glioma progression?

Despite recent advances, several critical research gaps remain regarding ATP1B3's function in gliomas:

Addressing these knowledge gaps would significantly advance our understanding of ATP1B3's role in glioma biology and potentially lead to novel therapeutic approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.