Recombinant Human Solute carrier family 22 member 3 (SLC22A3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
SLC22A3; EMTH; OCT3; Solute carrier family 22 member 3; Extraneuronal monoamine transporter; EMT; Organic cation transporter 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-556
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SLC22A3
Target Protein Sequence
MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS CKCGRNKKTPVSRSHL
Uniprot No.

Target Background

Function
This protein mediates the potential-dependent transport of various organic cations. It likely plays a crucial role in regulating the distribution of cationic neurotoxins and neurotransmitters within the brain.
Gene References Into Functions

SLC22A3 Gene Function and Associated Studies:

  1. Studies suggest that common SLC22A3 gene variations minimally impact pancreatic cancer risk, although the rs2504938 SNP shows a significant correlation with unfavorable prognosis in patients. PMID: 28272475
  2. SNPs in SLC22A3 and H3F3B may influence lipid levels by modulating local gene expression. PMID: 29894858
  3. A-to-I RNA editing of SLC22A3 contributes to the early development and progression of familial esophageal squamous cell carcinoma in high-risk individuals. PMID: 28533408
  4. Research indicates that several PHACTR1 and SLC22A3 gene polymorphisms may offer protection against coronary artery disease in Chinese Han males. PMID: 27893421
  5. SLC22A3 deletion is associated with motor speech disorders and language delays. PMID: 28767196
  6. SLC22A3 may regulate norepinephrine concentrations in adipose tissue. PMID: 28034777
  7. The rs3088442G>A variant may serve as a genetic marker for identifying individuals at increased risk of type 2 diabetes. PMID: 28625319
  8. The rs3088442 genotype within the SLC22A3-LPAL2-LPA gene cluster may influence plasma Lp(a) levels and coronary artery disease severity in a Chinese Han population. PMID: 27417586
  9. OCT3 plays a significant role in metformin absorption and elimination, affecting its bioavailability, clearance, and pharmacological action. PMID: 25920679
  10. Western blot analysis was used to detect EMT markers. PMID: 25322669
  11. The SLC22A3 variant rs3088442 G-->A may decrease coronary heart disease risk through a negative feedback mechanism against inflammatory responses. PMID: 25561729
  12. Cultured astrocyte line 1321N1 and primary human astrocytes transport monoamines partly through OCT3. PMID: 24471494
  13. No association was found between rs7758229 in 6q26-q27/SLC22A3 and colorectal cancer risk in a Chinese population. PMID: 23555006
  14. Reduced OCT3 and MATE1 expression in human placenta suggests a role in fetal protection, particularly in early gestation. PMID: 23303678
  15. Genetic polymorphisms in the OCT3 proximal promoter region affect gene transcription rates and may be linked to altered OCT3 expression in human liver. PMID: 22231567
  16. Increased Wnt3 in trastuzumab-resistant cells promotes a partial EMT-like transition. PMID: 23071104
  17. SNPs PDLIM5 (rs17021918,T), SLC22A3 (rs9364554,C), and NKX3-1 (rs1512268,A) do not appear to be associated with prostate cancer in Chinese men. PMID: 22741436
  18. No association was found between SNPs in the SLC22A3-LPAL2-LPA gene cluster and coronary artery disease risk in a Chinese Han population. PMID: 23036009
  19. NUDT11, HNF1B, and SLC22A3 genes are implicated in prostate cancer pathogenesis. PMID: 22730461
  20. SLC22A3 is highly expressed in the human heart, particularly in vascular endothelial cells, with no change in expression observed in failing left ventricular myocardium. PMID: 21697722
  21. OCT3 overexpression significantly increases cisplatin cellular accumulation and cytotoxicity in KB-3-1 cells. PMID: 21905038
  22. Evidence suggests a negative feedback mechanism regulating IL-4 production in basophils, involving OCT3 interaction with 5-HT and pharmacological ligands. PMID: 21636115
  23. Five SNPs are associated with reduced OCT3 transport activity (using 5-HT & MPP), based on genetic association studies. PMID: 20562519
  24. The regulation of EMT-mediated transport by second-messenger phosphorylation/dephosphorylation mechanisms has been studied in HEK293 cells using tritiated 1-methyl-4-phenylpyridinium as a substrate. PMID: 11770002
  25. EMT efficiently translocates agmatine and is a factor in controlling agmatine levels. PMID: 12538837
  26. Genetic variation of EMT was investigated in Caucasians. PMID: 12768439
  27. EMT expression in the rat brain area postrema suggests a role in physiological functions like emesis, food intake, and cardiovascular regulation. PMID: 14690517
  28. Organic cation transporter EMT mRNA was primarily detected in intra-lobular septa and scattered placental vessel adventitial cells, with lower expression in pre-eclamptic placentae. PMID: 15135235
  29. Ranitidine and famotidine exhibit differing inhibitory effects on SLC22A3. PMID: 16141367
  30. SLC22A3 polymorphisms are linked to polysubstance use in Japanese patients with methamphetamine dependence. PMID: 17010131
  31. PMAT, EMT, and OCT2 transporters expressed in the endometrial stroma may regulate monoamine reuptake, including histamine. PMID: 17393420
  32. Rare mutations in the EMT gene may contribute to or modify genetic subtypes of obsessive-compulsive disorder. PMID: 17477885
  33. Caki-1 cells are useful as a proximal tubule model for OCT3 research. PMID: 18253050
  34. Immature germ cell proliferation in germ cell tumors may involve an interaction between OCT3/4 and nuclear beta-catenin accumulation. PMID: 18295396
  35. The SLC22A3-LPAL2-LPA gene cluster is a strong susceptibility locus for coronary artery disease. PMID: 19198611
Database Links

HGNC: 10967

OMIM: 604842

KEGG: hsa:6581

STRING: 9606.ENSP00000275300

UniGene: Hs.567337

Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen.

Q&A

What is the structural and functional characterization of SLC22A3?

SLC22A3 (also known as organic cation transporter 3 or OCT3) belongs to the solute carrier family 22. The protein contains 12 predicted alpha-helical transmembrane domains (TMDs) with a large extracellular loop between TMD 1 and 2. It functions as a poly-specific transporter involved in the movement of various organic cations, drugs, xenobiotics, and endogenous compounds across cellular membranes. SLC22A3 primarily facilitates small intestinal absorption and hepatic and renal excretion of its substrates while performing homeostatic functions in heart and brain tissue .

For proper structural characterization in experimental settings, researchers should consider membrane protein production platforms that can prepare SLC22A3 in various formats such as detergent micelles, proteoliposomes, nanodiscs, or MP-VLPs, depending on the specific experimental requirements .

How does SLC22A3 differ from other members of the SLC22 family?

SLC22A3 is one of several members of the SLC22 family, which includes multiple transporters with distinct but related functions as outlined in the table below:

Transporter TypeSLC22 Family MembersPrimary Functions
Organic Cation Transporters (OCTs)SLC22A1-3 (OCT1-3)Transport of positively charged molecules
Zwitterion/Cation TransportersSLC22A4-5 (OCTN1-2)Transport of zwitterions and cations
Organic Anion TransportersSLC22A6-8, 11, 12 (OAT1-3, 4, 10)Transport of negatively charged molecules
Other SLC22SLC22A9, 10, 13, 14, 16, 17, 18Various transport functions

While SLC22A1 (OCT1) and SLC22A2 (OCT2) share functional similarities with SLC22A3, they exhibit different tissue expression patterns. SLC22A3 is more broadly expressed, particularly in placenta, heart, liver, kidney, and brain. Unlike some other family members, SLC22A3 has been implicated in cancer prognosis, with its expression levels correlating with survival outcomes in various cancer types .

What are the recommended methods for producing recombinant SLC22A3 for research purposes?

For producing high-quality recombinant human SLC22A3 protein suitable for research applications, multiple expression systems can be employed:

  • Mammalian expression systems: HEK293 or CHO cells are preferred for functional studies as they provide proper post-translational modifications and membrane trafficking.

  • Insect cell expression: Baculovirus-infected Sf9 or High Five cells often yield higher protein amounts while maintaining proper folding.

  • Cell-free systems: For rapid production, though with potentially lower functional quality.

For purification and stabilization, researchers should employ:

  • Detergent screening to identify optimal solubilization conditions

  • Nanodiscs or proteoliposomes for functional studies

  • Affinity tags (His, FLAG, or Strep) positioned to minimize interference with function

  • Size exclusion chromatography for final purification

Functionality assessment through substrate transport assays using radioactively labeled substrates or fluorescent probes is essential to confirm that the recombinant protein retains native activity .

How does SLC22A3 expression influence cancer progression and prognosis?

Mechanistically, SLC22A3 expression appears to influence cancer progression through several pathways:

  • Tumor microenvironment modulation: SLC22A3 expression positively correlates with immune-related pathways, particularly inflammatory responses and abundance of infiltrating immune cells in the tumor microenvironment.

  • Immunological checkpoint regulation: In SLC22A3-high groups, many genes encoding immunological checkpoint inhibitory molecules are upregulated.

  • Chemosensitivity impact: SLC22A3 expression has been shown to influence the sensitivity of tumor cells to chemotherapeutic medications in kidney carcinoma, colorectal cancer, and head and neck squamous cell cancer .

These findings suggest that researchers should consider SLC22A3 as a potential biomarker for prognosis in various cancers, though its predictive value appears to be cancer-type specific.

What is the relationship between SLC22A3 methylation status and gene expression in disease states?

DNA methylation appears to be a critical epigenetic mechanism regulating SLC22A3 expression across various disease states. In acute myeloid leukemia, hypermethylation of SLC22A3 has been associated with gene silencing and adverse clinical outcomes . The regulatory relationship between methylation and expression follows these patterns:

  • Inverse correlation: Higher methylation levels of SLC22A3 promoter regions correlate with lower gene expression.

  • Disease-specific methylation profiles: Different disease states show distinct methylation patterns of the SLC22A3 gene.

  • Prognostic significance: Methylation-mediated silencing of SLC22A3 predicts adverse outcomes in AML patients.

To study this relationship, researchers should employ:

  • Bisulfite sequencing to precisely map methylation patterns across the SLC22A3 gene

  • Quantitative PCR and Western blotting to correlate methylation status with transcript and protein levels

  • Demethylating agent experiments (e.g., 5-azacytidine treatment) to confirm causality between methylation and expression

  • Clinical correlation studies linking methylation patterns to patient outcomes

Understanding this relationship could potentially lead to therapeutic strategies targeting the epigenetic regulation of SLC22A3 in various diseases .

How do genetic polymorphisms in SLC22A3 influence drug response and disease susceptibility?

Genetic polymorphisms in SLC22A3 have significant implications for both drug response and disease susceptibility, particularly in type 2 diabetes mellitus (T2DM). Research examining Chinese populations has identified specific SNPs associated with T2DM risk and drug efficacy:

  • Disease susceptibility: The polymorphisms rs555754 and rs3123636 in SLC22A3 are significantly associated with T2DM susceptibility, while rs3088442 does not show the same association. Additionally, there is a haplotype association of SLC22A3 rs3088442-rs3123636 with T2DM susceptibility .

  • Drug response variation: SLC22A3 polymorphisms influence the efficacy of metformin, a first-line medication for T2DM. Variations in the transporter can alter drug uptake, distribution, and elimination.

  • Methodological considerations for researchers:

    • Genotyping approaches should include targeted SNP analysis and haplotype determination

    • Association studies should adjust for relevant covariates (age, sex, BMI)

    • Functional validation through in vitro transport assays with variant forms is essential

    • Population stratification must be addressed in study design

The clinical relevance of these polymorphisms suggests potential applications in personalized medicine, particularly for optimizing drug therapy in T2DM patients. Researchers investigating these associations should consider ancestral background variability, as findings from one population may not directly translate to others .

What are the optimal cell models for studying SLC22A3 function in different experimental contexts?

The selection of appropriate cell models is crucial for studying SLC22A3 function across various experimental objectives:

  • For basic transport kinetics studies:

    • HEK293 cells: Offer reliable expression of recombinant SLC22A3 with minimal endogenous transporter expression

    • MDCK cells: Provide polarized epithelial model suitable for vectorial transport studies

    • Xenopus oocytes: Allow electrophysiological measurements of transport activity

  • For tissue-specific function studies:

    • Primary hepatocytes: Ideal for studying liver-specific functions of SLC22A3

    • Renal proximal tubule cells: For investigating renal excretion mechanisms

    • Cardiomyocytes: To study homeostatic functions in heart tissue

    • Brain-derived cell lines: For neural transport studies

  • For disease-specific investigations:

    • Cancer cell lines with variable SLC22A3 expression: To study the impact on drug sensitivity

    • Patient-derived primary cells: To examine disease-specific alterations in transport function

When establishing these models, researchers should validate:

  • Expression levels through qPCR and Western blotting

  • Subcellular localization via immunofluorescence

  • Functional activity using substrate transport assays

  • Response to known inhibitors to confirm specificity

The experimental approach should be tailored to the specific research question, considering the advantages and limitations of each model system.

What methods are recommended for analyzing SLC22A3 expression and its correlation with clinical outcomes?

For robust analysis of SLC22A3 expression and its clinical correlations, researchers should implement a multi-modal approach:

  • RNA-level expression analysis:

    • RT-qPCR for targeted expression studies

    • RNA-seq for genome-wide expression profiling

    • FPKM cutoff values (≥5 has been used in previous studies) to categorize high vs. low expression

    • Maximally selected rank statistics (MSRS) technique for determining optimal survival cutpoints

  • Protein-level analysis:

    • Immunohistochemistry of tissue samples with standardized scoring systems

    • Western blotting for semi-quantitative analysis

    • Flow cytometry for cell-specific expression patterns

  • Methylation analysis:

    • Bisulfite sequencing to evaluate promoter methylation

    • Reduced representation bisulfite sequencing for genome-wide methylation profiling

    • Correlation of methylation status with expression levels

  • Clinical correlation methods:

    • Kaplan-Meier survival analysis stratified by expression levels

    • Cox proportional hazards modeling for multivariate analysis

    • Adjustment for relevant clinical covariates

    • Hot/cold tumor categorization based on immunogenicity scores

  • Validation approaches:

    • Independent cohort validation

    • Cross-platform normalization techniques

    • Non-parametric scaling to address platform-specific differences

These methodologies should be applied with careful consideration of technical variables and sample characteristics to ensure reproducible and clinically relevant findings.

How should researchers design experiments to investigate the impact of SLC22A3 on drug pharmacokinetics?

Designing robust experiments to investigate SLC22A3's impact on drug pharmacokinetics requires a comprehensive approach spanning in vitro, in vivo, and clinical studies:

  • In vitro transport studies:

    • Substrate identification: Employ cellular uptake assays with radiolabeled or fluorescent compounds

    • Kinetic characterization: Determine Km and Vmax parameters for key substrates

    • Inhibition profiling: Evaluate competitive and non-competitive inhibitors

    • Directional transport: Use transwell systems with polarized cells to assess vectorial movement

  • Genetic modification approaches:

    • Overexpression systems: Transfect cells with wild-type and variant SLC22A3

    • Knockdown/knockout models: Use siRNA, shRNA, or CRISPR-Cas9 to reduce or eliminate expression

    • Site-directed mutagenesis: Create specific variants to study structure-function relationships

  • In vivo pharmacokinetic studies:

    • Animal models: Use wild-type and Slc22a3-knockout mice

    • Tissue distribution analysis: Examine drug concentrations in relevant organs

    • Drug-drug interaction studies: Assess the impact of SLC22A3 inhibitors on substrate disposition

  • Clinical pharmacogenetic investigations:

    • Genotype-phenotype correlation: Relate SLC22A3 polymorphisms to drug disposition

    • Population pharmacokinetic modeling: Incorporate genetic data into PK models

    • Therapeutic drug monitoring: Correlate SLC22A3 status with drug levels and outcomes

  • Data analysis considerations:

    • Use physiologically-based pharmacokinetic (PBPK) modeling

    • Apply non-compartmental and compartmental analysis approaches

    • Consider machine learning methods for complex datasets

These experimental approaches should be tailored to the specific drug and research question, with appropriate controls and validation steps to ensure reliable and translatable results.

What are the main challenges in studying the role of SLC22A3 in disease progression?

Researchers investigating SLC22A3's role in disease progression face several significant challenges:

  • Context-dependent expression and function:

    • SLC22A3 shows tissue-specific expression patterns

    • The transporter exhibits seemingly contradictory roles in different cancer types (e.g., poor prognosis in LSCC but better prognosis in AML)

    • Functional impacts vary across disease states and cellular environments

  • Regulatory complexity:

    • Epigenetic regulation through DNA methylation creates variable expression patterns

    • Transcriptional control mechanisms remain incompletely characterized

    • Post-translational modifications may alter function in disease-specific ways

  • Methodological limitations:

    • Antibody specificity issues complicate protein detection

    • Membrane protein crystallization challenges limit structural insights

    • Transport assay standardization across research groups is lacking

  • Experimental model relevance:

    • Cell lines may not recapitulate the complex microenvironments of tissues

    • Animal models may have species-specific differences in SLC22A3 function

    • Patient heterogeneity complicates clinical correlation studies

  • Multifactorial disease interactions:

    • SLC22A3 effects may be modified by other transporters and metabolic enzymes

    • Environmental factors influence transporter expression and function

    • Genetic background affects the impact of specific polymorphisms

Addressing these challenges requires integrated approaches combining molecular, cellular, and clinical investigations with advanced computational methods to untangle the complex role of SLC22A3 in disease progression.

How can researchers address conflicting data regarding SLC22A3's impact on different cancer types?

The contradictory findings regarding SLC22A3's role across cancer types present a significant research challenge. To address these conflicts, researchers should:

  • Implement comprehensive molecular profiling:

    • Characterize SLC22A3 expression, methylation, and mutation status across multiple cancer types

    • Perform multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Analyze pathway activation patterns in SLC22A3-high versus SLC22A3-low tumors

    • Correlate with immune infiltration and microenvironment characteristics

  • Develop standardized methodology:

    • Establish consistent cutoffs for defining high versus low expression

    • Use identical statistical approaches across cancer types

    • Apply uniform sample processing and analysis protocols

    • Create reference datasets for cross-study comparison

  • Investigate mechanistic differences:

    • Examine cancer-specific substrates and their relationship to SLC22A3

    • Study tissue-specific interacting partners that may modify function

    • Analyze cell type-specific consequences of SLC22A3 expression

    • Investigate differences in subcellular localization and trafficking

  • Consider tumor microenvironment context:

    • Analyze SLC22A3's relationship with inflammatory signaling in each cancer type

    • Examine correlation with immune cell infiltration patterns

    • Study impact on immunological checkpoint molecules across cancers

    • Assess relationship with the Hot Oral Tumor (HOT) score as a measure of immunogenicity

  • Validate with functional studies:

    • Perform controlled SLC22A3 modulation experiments in multiple cancer cell lines

    • Use isogenic cell lines with SLC22A3 modification to control for genetic background

    • Develop co-culture systems to study microenvironment interactions

    • Apply in vivo models with conditional expression to assess temporal effects

Through systematic application of these approaches, researchers can begin to resolve the apparent contradictions in SLC22A3's role across cancer types and develop a more nuanced understanding of its context-dependent functions.

What emerging technologies might advance our understanding of SLC22A3 function and clinical applications?

Several cutting-edge technologies hold promise for advancing SLC22A3 research and translation:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structural determination

    • AlphaFold and related AI protein structure prediction tools

    • Molecular dynamics simulations to study substrate interactions and conformational changes

    • Structure-based drug design targeting SLC22A3

  • Single-cell technologies:

    • Single-cell RNA sequencing to resolve cell-specific expression patterns

    • Spatial transcriptomics to map SLC22A3 expression within tissue architecture

    • CyTOF and single-cell proteomics for protein-level characterization

    • Live-cell imaging of substrate transport at single-cell resolution

  • CRISPR-based technologies:

    • CRISPR screening to identify functional interactors and regulators

    • Base editing for precise introduction of clinically relevant polymorphisms

    • CRISPRi/CRISPRa for reversible modulation of expression

    • CRISPR-based epigenome editing to study methylation effects

  • Organoid and advanced culture systems:

    • Patient-derived organoids for personalized drug response testing

    • Microfluidic organ-on-chip models for physiological transport studies

    • 3D bioprinting of tissues with controlled SLC22A3 expression

    • Co-culture systems modeling complex cellular interactions

  • Clinical and translational applications:

    • Liquid biopsy approaches to monitor SLC22A3 methylation status

    • Development of SLC22A3 modulators for enhancing drug delivery

    • Point-of-care genotyping for SLC22A3 polymorphisms to guide therapy

    • Integration of SLC22A3 status into machine learning-based clinical decision support tools

These technologies, particularly when used in combination, have the potential to address current knowledge gaps, resolve contradictory findings, and accelerate the translation of SLC22A3 research into clinical applications for improved patient outcomes.

What are the best practices for designing experiments to investigate SLC22A3 polymorphisms and their functional consequences?

Investigating SLC22A3 polymorphisms requires careful experimental design. Researchers should follow these methodological best practices:

  • Polymorphism selection and characterization:

    • Prioritize SNPs with demonstrated clinical relevance (e.g., rs555754, rs3123636)

    • Consider both coding and regulatory region variants

    • Include tag SNPs to capture haplotype diversity

    • Analyze linkage disequilibrium patterns across populations

  • Genotyping approaches:

    • Select appropriate technology based on study scale (TaqMan assays for targeted studies, genotyping arrays or sequencing for broader investigations)

    • Include quality control samples and duplicate testing

    • Verify Hardy-Weinberg equilibrium to detect genotyping errors

    • Consider haplotype analysis in addition to individual SNPs

  • Functional validation strategies:

    • Generate variant constructs using site-directed mutagenesis

    • Express variants in appropriate cell models (HEK293, MDCK)

    • Perform quantitative transport assays with physiologically relevant substrates

    • Assess protein expression, localization, and stability differences

  • Clinical correlation methods:

    • Design adequately powered studies with appropriate control groups

    • Adjust for relevant demographic and clinical covariates (age, sex, BMI)

    • Consider ethnicity-specific effects and population stratification

    • Implement robust statistical approaches with correction for multiple testing

  • Translational considerations:

    • Assess impact on drug pharmacokinetics through ex vivo and in vivo studies

    • Develop predictive models integrating genetic data with clinical parameters

    • Validate findings across independent cohorts

    • Evaluate clinical utility through prospective studies

These methodological considerations are essential for producing reliable, reproducible, and clinically relevant data on SLC22A3 polymorphisms and their functional consequences.

How should researchers integrate multi-omics data to elucidate the role of SLC22A3 in disease?

Effective integration of multi-omics data for SLC22A3 research requires systematic approaches:

  • Data collection and preprocessing:

    • Genomics: Sequence SLC22A3 locus and regulatory regions

    • Epigenomics: Analyze methylation patterns using bisulfite sequencing

    • Transcriptomics: Quantify expression using RNA-seq with appropriate normalization

    • Proteomics: Measure protein levels and post-translational modifications

    • Metabolomics: Profile SLC22A3 substrates and related metabolites

  • Integration methodologies:

    • Correlation analysis across omics layers

    • Network-based approaches to identify functional modules

    • Machine learning for pattern recognition and prediction

    • Causal modeling to infer regulatory relationships

  • Disease-specific considerations:

    • Cancer: Correlate with immune infiltration and tumor microenvironment data

    • Diabetes: Integrate with metabolic parameters and drug response data

    • Cardiovascular disease: Analyze in context of cardiac function biomarkers

    • Neurological disorders: Consider blood-brain barrier function

  • Visualization and interpretation:

    • Develop multi-dimensional visualizations of integrated data

    • Use pathway enrichment analysis to contextualize findings

    • Apply causal reasoning algorithms to infer mechanistic relationships

    • Implement knowledge graphs to leverage existing biological information

  • Validation strategies:

    • Design targeted experiments to test hypotheses generated from integrated analysis

    • Utilize orthogonal techniques to confirm key findings

    • Validate in independent cohorts with different characteristics

    • Apply editing technologies to mechanistically validate predictions

Through systematic integration of multi-omics data, researchers can develop comprehensive models of SLC22A3 function in health and disease, leading to novel insights and potential therapeutic applications.

What quality control measures are essential when studying SLC22A3 gene expression and function?

Rigorous quality control is essential for generating reliable data on SLC22A3. Researchers should implement the following measures:

  • Gene expression analysis QC:

    • Validate primer specificity through sequencing and melting curve analysis

    • Use multiple reference genes selected for stability in the experimental context

    • Include no-template and no-RT controls in qPCR experiments

    • Verify antibody specificity using knockout/knockdown controls

    • Apply consistent FPKM cutoffs (e.g., ≥5) when categorizing expression levels

  • Functional assay standardization:

    • Characterize cell models for endogenous transporter expression

    • Validate recombinant expression using both mRNA and protein detection

    • Include positive and negative controls in transport assays

    • Verify substrate purity and stability

    • Perform saturation kinetics to distinguish transporter-mediated from passive processes

  • Genetic and epigenetic analysis QC:

    • Include technical and biological replicates in methylation studies

    • Verify bisulfite conversion efficiency using controls

    • Apply stringent quality filters to sequencing data

    • Use multiple methods to confirm polymorphism genotypes in critical samples

    • Validate key findings using orthogonal techniques

  • Data analysis safeguards:

    • Develop robust protocols for outlier identification

    • Apply appropriate normalization methods for cross-platform comparisons

    • Use non-parametric scaling for cross-platform normalization when necessary

    • Implement rigorous statistical approaches with correction for multiple testing

    • Validate findings in independent datasets

  • Reporting standards:

    • Document detailed experimental protocols

    • Report all quality control metrics

    • Adhere to MIQE guidelines for qPCR experiments

    • Follow REMARK guidelines for biomarker studies

    • Provide complete method descriptions for reproducibility

By implementing these quality control measures, researchers can enhance the reliability and reproducibility of SLC22A3 studies, ensuring that results are robust and biologically meaningful.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.