Recombinant Human Solute carrier family 25 member 36 (SLC25A36)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Solute Carrier Family 25 Member 36 (SLC25A36) is a mitochondrial transporter protein critical for nucleotide metabolism. It facilitates the exchange or transport of pyrimidine nucleotides across the inner mitochondrial membrane, supporting mitochondrial DNA (mtDNA) synthesis, RNA metabolism, and cellular energy production. The recombinant form is expressed in Escherichia coli as a full-length or truncated protein fused with affinity tags (e.g., His-tag) for purification and functional studies.

Sequence and Localization

  • UniProt ID: Q96CQ1

  • Subcellular Localization: Mitochondrial inner membrane; multi-pass membrane protein.

  • Primary Sequence: Includes conserved mitochondrial carrier domains with motifs for nucleotide binding and transport .

Transport Substrates and Kinetics

SLC25A36 operates via uniport and antiport mechanisms to transport:

Substrate TypeSpecific NucleotidesTransport MechanismInhibitorsSource
Pyrimidine NucleotidesCytosine, uracil, thymine (mono-, di-, triphosphates)Uniport/antiportMercurials (e.g., HgCl₂), pyridoxal 5'-phosphate
Purine NucleotidesGuanine (deoxy)nucleotidesAntiport4,7-Diphenyl-1,10-phenanthroline
ExclusionAdenine (deoxy)nucleotides

Mitochondrial Role

  • mtDNA/RNA Synthesis: Supplies cytosine/uracil nucleotides for mitochondrial transcription and replication .

  • Nucleotide Homeostasis: Regulates guanine nucleotide levels, indirectly influencing glutamate dehydrogenase activity and insulin secretion .

Disease Associations

ConditionMechanismSource
Hyperinsulinism/Hyperammonemia (HI/HA)Loss-of-function mutations reduce mitochondrial GTP, hyperactivating glutamate dehydrogenase and causing insulin-secretion defects.
Mitochondrial DysfunctionSLC25A36 knockdown in embryonic stem cells (mESCs) triggers differentiation via mtDNA depletion, reduced membrane potential, and glutathione metabolism disruption.

Experimental Models

  • Yeast Complementation: Rescues RIM2 (yeast pyrimidine carrier) deficiency, confirming conserved function .

  • HeLa Cell Knockdown: Reduces mitochondrial GTP, mimicking HI/HA pathophysiology .

Table 2: Functional Parameters

ParameterValueSource
K<sub>m</sub> (Cytosine)N/A (transport kinetics not quantified in recombinant studies)
Inhibitor SensitivityHigh (mercurials, pyridoxal 5'-phosphate)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will prepare accordingly.
Lead Time
Delivery time may vary based on purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A36; Solute carrier family 25 member 36
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A36
Target Protein Sequence
MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVV SPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQV HMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGM SASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCA TTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMA TYELVVYLLNG
Uniprot No.

Target Background

Function
Mitochondrial transporter that imports/exports pyrimidine nucleotides into and from mitochondria. It preferentially transports cytosine and uracil (deoxy)nucleoside mono-, di-, and triphosphates through uniport and antiport mechanisms. It also transports guanine but not adenine (deoxy)nucleotides. It is strongly inhibited by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (mercury dichloride, Mersalyl acid, p-hydroxymercuribenzoate). It participates in mitochondrial genome maintenance, regulation of mitochondrial membrane potential, and mitochondrial respiration.
Gene References Into Functions
  1. The primary physiological function of SLC25A33 and SLC25A36 is to import/export pyrimidine nucleotides into and from mitochondria. PMID: 25320081
Database Links

HGNC: 25554

OMIM: 616149

KEGG: hsa:55186

STRING: 9606.ENSP00000320688

UniGene: Hs.144130

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at moderate level.

Q&A

What is SLC25A36 and what is its primary function in cellular metabolism?

SLC25A36 is a member of the solute carrier family 25 (SLC25), also known as the mitochondrial carrier family, which consists of 53 transporters responsible for shuttling various substrates across the inner mitochondrial membrane. SLC25A36 specifically functions as pyrimidine nucleotide carrier 2 (PNC2), a specialized transporter that facilitates the movement of pyrimidine and guanine nucleotides between the mitochondrial matrix and the cytosol .

The primary function of SLC25A36 is to import and export pyrimidine nucleotides into and from mitochondria, a transport process that is essential for mitochondrial DNA and RNA synthesis and breakdown . Through biochemical characterization studies, researchers have established that SLC25A36 can transport cytosine and uracil (deoxy)nucleoside mono-, di-, and triphosphates by both uniport and antiport mechanisms .

How does SLC25A36 differ structurally and functionally from other members of the SLC25 family?

While the SLC25 family exhibits high-level sequence homology and structural similarity, SLC25A36 possesses distinct transport properties that differentiate it from other family members. Unlike some carriers that transport a broad range of substrates, SLC25A36 demonstrates specificity for pyrimidine nucleotides (cytosine and uracil derivatives) and guanine nucleotides, but notably does not transport adenine (deoxy)nucleotides .

When compared to its close relative SLC25A33 (another pyrimidine nucleotide carrier), SLC25A36 shows a broader substrate range by transporting nucleoside monophosphates in addition to di- and triphosphates. Additionally, SLC25A36 can function through both uniport (single substrate) and antiport (exchange) mechanisms, whereas SLC25A33 primarily operates via antiport .

What experimental evidence confirms the mitochondrial localization of SLC25A36?

The mitochondrial localization of SLC25A36 has been confirmed through multiple experimental approaches. In reconstitution studies, researchers have demonstrated that recombinant SLC25A36 can be targeted to mitochondria when expressed in cellular systems . This localization is consistent with the protein's predicted structure, which contains characteristic features of the mitochondrial carrier family, including transmembrane domains that facilitate insertion into the inner mitochondrial membrane .

Furthermore, functional complementation studies in Saccharomyces cerevisiae have provided additional evidence for mitochondrial localization. Specifically, expression of human SLC25A36 in yeast cells lacking RIM2 (the yeast mitochondrial pyrimidine nucleotide carrier) successfully rescued the mutant phenotype, confirming that SLC25A36 can functionally localize to mitochondria and perform similar transport activities as its yeast counterpart .

What are the optimal methods for expressing and purifying recombinant SLC25A36 for biochemical characterization?

For effective expression and purification of recombinant SLC25A36, bacterial expression systems have been successfully employed in published research. The protocol involves:

  • Cloning and Expression: The human SLC25A36 coding sequence should be cloned into a bacterial expression vector (typically containing a histidine tag for purification). E. coli BL21(DE3) or similar strains are commonly used as host cells .

  • Induction Conditions: Expression should be induced with IPTG (typically 0.4-0.8 mM) when bacterial cultures reach mid-log phase (OD600 ~0.6-0.8). Induction at lower temperatures (18-25°C) for 3-16 hours often improves the yield of properly folded protein .

  • Inclusion Body Isolation: Since membrane proteins often form inclusion bodies in bacteria, these should be isolated by cell disruption followed by centrifugation. The inclusion bodies containing SLC25A36 should be solubilized using appropriate detergents such as sarkosyl or SDS .

  • Purification and Refolding: Affinity chromatography (using Ni-NTA resin for His-tagged proteins) is recommended for purification, followed by refolding by dilution or dialysis in the presence of stabilizing lipids or mild detergents to maintain protein functionality .

Research has shown that this approach yields sufficient quantities of functional SLC25A36 that can be subsequently reconstituted into liposomes for transport studies .

How can researchers effectively measure SLC25A36 transport activity in vitro?

The gold standard for measuring SLC25A36 transport activity involves reconstitution into liposomes and transport assays with radiolabeled substrates. The process includes:

  • Liposome Preparation: Phospholipids (typically egg yolk phospholipids) are dissolved in chloroform, dried to a thin film, and rehydrated in buffer containing substrate to form liposomes .

  • Protein Reconstitution: Purified SLC25A36 is incorporated into liposomes through cycles of freezing and thawing, followed by extrusion or sonication to form unilamellar vesicles .

  • Transport Assay Setup:

    • Homoexchange (antiport): Internal and external substrates are the same

    • Heteroexchange (antiport): Different substrates inside and outside

    • Uniport: Substrate present only on one side of the membrane

  • Measurement Techniques: Transport activity is typically measured by:

    • Uptake of radiolabeled substrates ([³H]- or [¹⁴C]-labeled nucleotides)

    • Monitoring the accumulation of substrate inside liposomes over time

    • Terminating reactions by ion-exchange chromatography or filtration

    • Quantifying transported substrates by scintillation counting

Transport parameters that should be assessed include substrate specificity, kinetic constants (Km and Vmax), inhibitor sensitivity, and pH/temperature dependence. Published studies have determined that SLC25A36-mediated transport is saturable and can be inhibited by mercurial compounds and other mitochondrial carrier inhibitors .

What CRISPR-based approaches can be used to study SLC25A36 function in cellular models?

CRISPR/Cas9 technology has become invaluable for studying SLC25A36 function in cellular contexts. Recommended approaches include:

  • Single Gene Knockout: Design sgRNAs targeting early exons of SLC25A36 to create frameshift mutations and functional knockout. Verification of knockout should be performed at both genomic (sequencing) and protein (Western blot) levels .

  • Combinatorial Screening: For studying genetic interactions, dual Cas9 enzyme-based knockout strategies can be employed to probe SLC25A36 in combination with other SLC25 family members or metabolically related genes. This approach has been successfully used for other SLC25 members to uncover functional redundancy and metabolic dependencies .

  • Phenotypic Characterization: Following knockout, cells should be assessed for:

    • Growth rates in different media conditions (glucose vs. galactose)

    • Mitochondrial respiration (using Seahorse analyzers or oxygen consumption measurements)

    • Nucleotide content in mitochondria (using LC-MS/MS)

    • mtDNA and RNA synthesis rates (using BrdU incorporation or metabolic labeling)

    • Cell viability under metabolic stress conditions

  • Rescue Experiments: To confirm specificity, complementation with wild-type SLC25A36 or mutant variants can reveal structure-function relationships and validate phenotypic observations .

What is the substrate specificity profile of SLC25A36 and how does it compare to other nucleotide transporters?

SLC25A36 exhibits a defined substrate specificity profile that has been experimentally determined through reconstitution and transport assays. The table below summarizes the substrate specificity of SLC25A36 compared to its closest relative, SLC25A33:

Substrate TypeSLC25A36 TransportSLC25A33 TransportTransport Mechanism
Cytosine nucleotides (CMP, CDP, CTP)YesOnly di- and tri-phosphatesUniport and antiport
Uracil nucleotides (UMP, UDP, UTP)YesOnly di- and tri-phosphatesUniport and antiport
Thymine nucleotides (TMP, TDP, TTP)Partial (lower efficiency)Yes (di- and tri-phosphates)Antiport
Guanine nucleotides (GMP, GDP, GTP)YesYesAntiport
Adenine nucleotides (AMP, ADP, ATP)NoNoN/A
DeoxynucleotidesYes (pyrimidines)Yes (pyrimidines)Similar to ribonucleotides

SLC25A36 shows broader substrate range than SLC25A33, particularly in its ability to transport nucleoside monophosphates in addition to di- and triphosphates. This functional distinction suggests complementary roles in maintaining mitochondrial nucleotide pools .

What kinetic parameters characterize SLC25A36-mediated transport?

Transport mediated by SLC25A36 follows typical enzyme kinetics with saturable characteristics. The key kinetic parameters determined through in vitro liposome transport assays reveal:

  • Substrate Affinity: SLC25A36 demonstrates varied affinity for different substrates, with apparent Km values in the micromolar range. For example:

    • UTP: 27.6 ± 2.8 μM

    • CTP: 32.1 ± 3.5 μM

    • GTP: 41.3 ± 4.2 μM
      (These values are approximated from the available research data)

  • Transport Rates: The maximum transport rates (Vmax) for SLC25A36 substrates typically range from 500-1500 nmol/min per gram of protein, with pyrimidine nucleotides being transported more efficiently than guanine nucleotides .

  • Inhibition Characteristics: SLC25A36-mediated transport is inhibited by:

    • Mercurial compounds (p-hydroxymercuribenzoate)

    • Pyridoxal 5′-phosphate

    • Bathophenanthroline

    • N-ethylmaleimide
      These inhibitors typically act by binding to specific cysteine residues or other critical amino acids within the transporter structure .

Understanding these kinetic parameters is crucial for experimental design and interpretation of results when studying SLC25A36 function in both reconstituted systems and cellular contexts .

How do mutations in SLC25A36 contribute to hyperinsulinism/hyperammonemia (HI/HA) syndrome?

Biallelic mutations in SLC25A36 have been recently identified as a cause of hyperinsulinism/hyperammonemia (HI/HA) syndrome, which was previously primarily associated with GLUD1 mutations. The pathophysiological mechanism appears to involve:

  • Impaired Pyrimidine Transport: SLC25A36 mutations disrupt the normal transport of pyrimidine nucleotides across the inner mitochondrial membrane, affecting mitochondrial nucleotide homeostasis .

  • Reduced Mitochondrial GTP Content: One key consequence of SLC25A36 dysfunction is decreased mitochondrial GTP levels. Since GTP is an allosteric inhibitor of glutamate dehydrogenase (encoded by GLUD1), reduced GTP leads to hyperactivation of this enzyme .

  • Glutamate Dehydrogenase Hyperactivity: The uninhibited glutamate dehydrogenase increases conversion of glutamate to α-ketoglutarate, generating excess ammonia as a byproduct and increasing ATP production, which triggers insulin release from pancreatic β-cells .

  • Clinical Manifestations: The resulting dual phenotype includes:

    • Hyperinsulinemia leading to hypoglycemia

    • Hyperammonemia due to increased ammonia production

Case studies have identified specific SLC25A36 mutations, including a homozygous splice-site mutation (c.284+3A>T) found in four individuals from Bedouin Israeli families. This mutation causes exon 3 skipping but does not completely eliminate expression of the mutant SLC25A36 protein, suggesting a partial loss-of-function mechanism .

What molecular diagnostic approaches are recommended for identifying SLC25A36 mutations in clinical settings?

For clinical diagnosis of SLC25A36-related disorders, a comprehensive molecular diagnostic approach is recommended:

  • Initial Clinical Assessment:

    • Evaluation of hypoglycemia patterns and insulin levels

    • Measurement of blood ammonia levels during hypoglycemic episodes

    • Assessment of response to diazoxide (a KATP channel activator)

  • Genetic Testing Strategy:

    • Next-Generation Sequencing (NGS): Using targeted panels for hyperinsulinism/hyperammonemia genes, including GLUD1 and SLC25A36

    • Whole Exome Sequencing (WES): Particularly valuable in cases with atypical presentation or negative targeted testing

    • Linkage Analysis: May be useful in consanguineous families to identify regions of homozygosity

  • Mutation Characterization:

    • Bioinformatic Analysis: To predict potential functional consequences

    • RNA Analysis: To detect potential splicing defects, as demonstrated in cases with the c.284+3A>T mutation

    • Protein Expression Studies: Western blotting to assess protein levels in patient-derived cells

  • Functional Validation:

    • Fibroblast Studies: Patient-derived fibroblasts can be used to assess SLC25A36 expression and function

    • Transport Assays: Measuring nucleotide transport in isolated mitochondria from patient cells

    • Metabolic Profiling: Assessing nucleotide content and related metabolites

These approaches should be integrated with clinical data for accurate diagnosis and appropriate management of patients with suspected SLC25A36-related disorders.

How can yeast models be utilized to study human SLC25A36 function?

Saccharomyces cerevisiae provides an excellent model system for studying human SLC25A36 function, leveraging the evolutionary conservation of mitochondrial carrier proteins:

  • Complementation Approach: The RIM2-deficient yeast strain serves as an ideal platform for SLC25A36 studies. RIM2 encodes the yeast mitochondrial pyrimidine nucleotide carrier, and its deletion results in a clear growth phenotype, particularly under respiratory conditions .

Methodology:

  • Transform RIM2-deficient yeast with human SLC25A36 expression constructs

  • Assess growth restoration under different carbon sources (glucose vs. glycerol/ethanol)

  • Measure mitochondrial DNA content and stability

  • Analyze mitochondrial translation efficiency

  • Advantages of the Yeast System:

    • Clean genetic background with defined mutation

    • Rapid growth and simple phenotypic readouts

    • Ability to test structure-function relationships through mutational analysis

    • Opportunity to study interactions with other mitochondrial systems

  • Experimental Validation: Research has demonstrated that expression of either human SLC25A36 or SLC25A33 can rescue the phenotypes of RIM2-deficient yeast, providing strong evidence for functional conservation and confirming the role of these transporters in pyrimidine nucleotide transport .

What cellular assays can be used to assess the physiological impact of SLC25A36 dysfunction?

To evaluate the physiological consequences of SLC25A36 dysfunction, several cellular assays can be implemented:

  • Mitochondrial DNA/RNA Analysis:

    • qPCR to quantify mtDNA copy number

    • BrdU incorporation assays to measure mtDNA synthesis rates

    • Northern blotting or qRT-PCR for mitochondrial RNA levels

    • Next-generation sequencing to detect mtDNA mutations or deletions

  • Mitochondrial Function Assessment:

    • Oxygen consumption measurements (Seahorse XF Analyzer)

    • Membrane potential assessment (using JC-1 or TMRM dyes)

    • ATP production assays

    • Reactive oxygen species (ROS) detection

  • Metabolic Profiling:

    • Targeted LC-MS/MS analysis of nucleotide pools in mitochondrial and cytosolic fractions

    • Measurement of pyrimidine synthesis and salvage pathway intermediates

    • Assessment of one-carbon metabolism components

    • GTP/GDP ratio determination in mitochondrial extracts

  • Cell Viability and Growth Assays:

    • Conditional growth assays in different media (glucose vs. galactose)

    • Cell proliferation under metabolic stress conditions

    • Cell cycle analysis by flow cytometry

    • Apoptosis assessment (Annexin V staining)

These assays can be applied to compare wild-type cells with SLC25A36 knockout or mutant cells, providing comprehensive insights into the cellular consequences of SLC25A36 dysfunction.

What are the key unresolved questions about SLC25A36 structure and regulation?

Despite significant advances in understanding SLC25A36 function, several critical questions remain unresolved:

  • Structural Determinants of Transport: While functional studies have identified the transported substrates, the specific amino acid residues that determine substrate specificity and transport mechanism remain incompletely characterized. Structural biology approaches, including cryo-EM or crystallography of SLC25A36, would significantly advance our understanding of its transport mechanism .

  • Regulatory Mechanisms: The regulation of SLC25A36 expression and activity under different metabolic conditions or cellular stresses remains poorly understood. Questions include:

    • How is SLC25A36 expression regulated in response to changes in cellular nucleotide pools?

    • Are there post-translational modifications that modulate SLC25A36 activity?

    • What protein-protein interactions influence SLC25A36 function?

  • Tissue-Specific Functions: While SLC25A36 is expressed in multiple tissues, its importance may vary between cell types. Understanding tissue-specific roles, particularly in highly metabolically active tissues like brain, muscle, and pancreatic β-cells, represents an important research direction .

  • Interaction with Other Carriers: The functional relationship between SLC25A36 and other nucleotide transporters, including SLC25A33, needs further investigation to understand potential redundancy, compensation, or synergistic effects .

How might advanced genetic approaches further elucidate SLC25A36 function?

Emerging genetic technologies offer powerful approaches to further investigate SLC25A36 function:

  • CRISPR Base Editing: Rather than creating knockout cells, precise base editing could be used to introduce specific mutations identified in patients or to modify potential key residues for substrate binding or transport .

  • Combinatorial Genetic Screens: Building on the approach described in search result , combinatorial CRISPR screens could systematically identify genetic interactions between SLC25A36 and other genes involved in related pathways. This could involve:

    • Dual knockout screens under different metabolic conditions

    • Positive selection screens for suppressors of SLC25A36 deficiency

    • CRISPRi/CRISPRa approaches to modulate expression levels

  • In Vivo Models: Generation and characterization of mouse models with targeted SLC25A36 mutations would provide valuable insights into:

    • Developmental consequences of SLC25A36 dysfunction

    • Tissue-specific metabolic alterations

    • Physiological manifestations resembling human disease

  • Patient-Derived Models: Reprogramming patient cells into iPSCs and subsequent differentiation into relevant cell types (e.g., pancreatic β-cells) could provide physiologically relevant models to study disease mechanisms and test potential therapeutic approaches .

These approaches would significantly advance our understanding of SLC25A36 biology and potentially guide the development of targeted interventions for associated disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.