Recombinant Human Solute carrier family 25 member 41 (SLC25A41)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Transport

SLC25A41 is an electroneutral ATP-Mg/P<sub>i</sub> exchanger critical for adenine nucleotide homeostasis . Its transport mechanism involves:

  • Substrates:

    • Primary: ATP-Mg, ADP, phosphate (P<sub>i</sub>) .

    • Secondary: Dephospho-CoA and adenosine 3′,5′-diphosphate (PAP) .

  • Kinetic Properties:

    • High affinity for CoA (KmK_m ~5–10 μM) .

    • Calcium-independent transport, unlike paralogs SLC25A24/23 .

Comparison with ParalogsSLC25A41SLC25A24/23
Calcium RegulationNoYes
Tissue ExpressionTestis, brainBroad
Role in Energy MetabolismATP-Mg/P<sub>i</sub> exchangeATP-Mg/P<sub>i</sub> exchange with Ca<sup>2+</sup> sensitivity

Expression Systems

Recombinant SLC25A41 is produced in multiple platforms:

  • Bacterial Systems: E. coli for cost-effective, high-yield production .

  • Mammalian Systems: HEK293 for post-translational modifications .

Research Applications

  • Metabolic Studies: Investigating mitochondrial adenine nucleotide flux .

  • Antibody Development: Anti-SLC25A41 antibodies (e.g., ab126372) for immunohistochemistry .

  • Disease Modeling: Links to altered methylation under bisphenol A exposure .

Transport Mechanism

  • SLC25A41 operates via a strict counter-exchange mechanism, requiring substrate binding on both sides of the membrane .

  • Inhibitors: Bongkrekic acid and other mitochondrial carrier blockers reduce activity .

Physiological Relevance

  • Maintains mitochondrial ATP pools during division and macromolecular synthesis .

  • Critical for spermatogenesis and neuronal function due to preferential expression in testis and brain .

Future Directions

  • Therapeutic Targeting: Potential role in metabolic disorders or cancers with dysregulated mitochondrial energetics .

  • Cryo-EM Studies: High-resolution structural analysis to elucidate transport dynamics.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A41; Mitochondrial carrier protein SCaMC-3L; Mitochondrial ATP-Mg/Pi carrier protein SLC25A41; Small calcium-binding mitochondrial carrier protein 3-like; SCaMC-3-like; SCaMC-3L; Solute carrier family 25 member 41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A41
Target Protein Sequence
MGAQPGEPQNTCSRIQTLFRRVKTLLIKAPPPPQPPPPPPSWNPGCTHVYGYAFGHMHDN NLEHLPSQQVLDTGEQLMVPVEVLEVDNKEALWKFLLSGAMAGAVSRTGTAPLDRAKVYM QVYSSKTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGI QGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRA LYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMAS YPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVV YEAMKKTLGI
Uniprot No.

Target Background

Function
Calcium-independent ATP-Mg/Pi exchanger that catalyzes the electroneutral exchange of Mg-ATP or free ADP against an hydrogenphosphate. It participates in the net transport of adenine nucleotides across the mitochondria inner membrane.
Gene References Into Functions
  1. The APC4 subunit is the major SUMO target in the anaphase-promoting complex/cyclosome, containing SUMO acceptor lysines at positions 772 and 798. PMID: 29549242
  2. Provides a comprehensive comparison and contrast of all known human SLC25A* genes, including functional information. PMID: 23266187
Database Links

HGNC: 28533

OMIM: 610822

KEGG: hsa:284427

STRING: 9606.ENSP00000322649

UniGene: Hs.375135

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A41 and to which protein family does it belong?

SLC25A41 (Solute Carrier Family 25, Member 41) belongs to the mitochondrial carrier family that facilitates the transport of metabolites across the inner mitochondrial membrane. Like other members of the SLC25 family, it plays a crucial role in linking cytosolic and mitochondrial metabolism to support cellular maintenance and growth . The human SLC25A41 protein consists of 370 amino acids and shares structural characteristics with other mitochondrial carriers, including a central substrate-binding site and transmembrane domains .

What is the structural composition of recombinant human SLC25A41?

Recombinant human SLC25A41 typically encompasses the full protein sequence (amino acids 1-370). The protein sequence begins with MGAQPGEPQN and continues through to YEAMKKTLGI . When expressed recombinantly, it can be labeled with purification tags such as a His-tag to facilitate isolation and purification processes. The protein likely contains the characteristic structural elements of the SLC25 family, including transmembrane helices forming a barrel-like structure with a central substrate-binding site and two gates with salt bridge networks that regulate access to this binding site from both sides of the membrane .

How does SLC25A41 compare to other members of the SLC25 family?

While specific comparative data for SLC25A41 is limited in the provided sources, the SLC25 family operates with similar mechanisms. Most SLC25 carriers function as monomers (with exceptions like the dimeric SLC25A13) and operate with a ping-pong kinetic mechanism where substrate import and export occur consecutively . Like its family members, SLC25A41 likely contains a single central substrate-binding site and two gates with salt bridge networks and braces that regulate substrate access . Other well-characterized family members include the ADP/ATP carrier (SLC25A4), citrate carrier (SLC25A1), dicarboxylate carrier (SLC25A10), and oxoglutarate carrier (SLC25A11) .

What expression systems are optimal for producing recombinant SLC25A41?

For optimal expression of recombinant SLC25A41, mammalian expression systems, particularly HEK-293 cells, have demonstrated successful protein production . These systems are preferred for SLC25 family members because they provide proper post-translational modifications and membrane integration, which are critical for maintaining structural integrity and function of mitochondrial carrier proteins. The optimized expression system ensures reliability for intracellular, secreted, and transmembrane proteins like SLC25A41 . The choice of expression system significantly impacts protein folding, targeting, and functionality, making mammalian cells particularly suitable for complex membrane proteins.

What purification strategies yield the highest purity of recombinant SLC25A41?

The most effective purification strategy for SLC25A41 involves affinity chromatography using a His-tag system . This approach typically yields purity levels exceeding 90% as determined by analytical methods . The general protocol includes:

  • Expression in HEK-293 cells with an N-terminal or C-terminal His-tag

  • Cell lysis under conditions that maintain protein structure

  • One-step affinity chromatography using nickel or cobalt resins

  • Elution with imidazole gradient

  • Buffer exchange to remove imidazole and stabilize the protein

Additional purification steps may include size exclusion chromatography to separate monomers from potential aggregates, particularly important when studying oligomeric states .

How can researchers verify the functional integrity of purified SLC25A41?

To verify functional integrity of purified SLC25A41, researchers should employ multiple complementary approaches:

  • Liposome reconstitution assays: Incorporate purified SLC25A41 into liposomes and measure transport activity of potential substrates using radioisotope-labeled compounds or fluorescence-based assays .

  • Biophysical characterization: Use circular dichroism to assess secondary structure, thermal shift assays to determine stability, and dynamic light scattering to confirm monodispersity.

  • Binding assays: Employ isothermal titration calorimetry or microscale thermophoresis to measure substrate binding affinities.

  • Structural validation: Utilize limited proteolysis to confirm proper folding and resistance to degradation.

These approaches collectively provide strong evidence for functional integrity beyond simple purity assessment .

What is the most likely transport mechanism for SLC25A41?

Based on research with other SLC25 family members, SLC25A41 most likely operates with a ping-pong (double-displacement) kinetic mechanism rather than a sequential mechanism . In this model, substrate import and export occur consecutively rather than simultaneously. The carrier would have a single central substrate-binding site that is alternately accessible from either side of the membrane, consistent with an alternating-access mechanism . The transport process likely involves conformational changes where the carrier alternates between states exposing the binding site to either the mitochondrial matrix or the intermembrane space .

How should researchers design experiments to accurately determine SLC25A41 kinetics?

To accurately determine SLC25A41 kinetics, researchers should implement the following experimental design principles:

  • Reconstitution into liposomes: Incorporate purified SLC25A41 into liposomes with defined lipid composition to mimic the mitochondrial inner membrane environment.

  • Robotic transport assays: Utilize automated systems to ensure precise timing and reproducibility across multiple conditions .

  • Substrate concentration matrices: Test multiple internal and external substrate concentrations to generate comprehensive kinetic data.

  • Initial rate measurements: Focus on measuring transport rates during the linear phase of activity, avoiding substrate depletion effects.

  • Selection of appropriate buffers: Use buffers that do not interfere with transport activity or compete with substrates .

  • Data analysis beyond Lineweaver-Burk plots: Apply multiple methods of analysis including direct fitting to kinetic equations rather than relying solely on linearized plots that overemphasize less accurate measurements .

  • Control experiments: Include controls to account for non-specific binding and leakage from liposomes.

What are the potential substrates for SLC25A41 based on other SLC25 family members?

While specific substrates for SLC25A41 are not directly identified in the provided sources, potential substrates can be inferred from related family members:

  • Nucleotides: Similar to SLC25A4 (ADP/ATP carrier), SLC25A41 might transport adenine nucleotides .

  • Carboxylates: Based on SLC25A1 (citrate carrier), SLC25A10 (dicarboxylate carrier), and SLC25A11 (oxoglutarate carrier), potential substrates could include di- and tricarboxylates such as citrate, malate, succinate, or 2-oxoglutarate .

  • Amino acids: SLC25A13 (aspartate/glutamate carrier) suggests amino acid transport potential, particularly acidic amino acids .

Substrate prediction should be followed by experimental validation using reconstituted liposomes and transport assays with various radiolabeled or fluorescently-labeled compounds.

What techniques are most effective for determining the oligomeric state of SLC25A41?

To accurately determine the oligomeric state of SLC25A41, researchers should employ multiple complementary techniques to avoid the methodological pitfalls seen in earlier studies of SLC25 carriers :

  • Size exclusion chromatography with multi-angle laser light scattering (SEC-MALS): This technique provides absolute molecular weight determination independent of shape and is superior to standard gel filtration which has led to conflicting results for other SLC25 carriers .

  • Analytical ultracentrifugation: Provides information about the molecular weight and shape of proteins in solution without interaction with a matrix.

  • Blue native PAGE with appropriate controls: While this method has historically given conflicting results for some SLC25 carriers, careful calibration and controls can provide valuable supporting evidence .

  • Cross-linking mass spectrometry: Identifies proximity between protein regions to infer oligomeric arrangements.

  • Single-particle cryo-electron microscopy: Directly visualizes protein structure in a near-native state to determine oligomeric arrangement.

The consensus from studies on other SLC25 family members suggests SLC25A41 likely functions as a monomer, though definitive studies specific to this protein are needed .

How can researchers identify potential protein interaction partners of SLC25A41?

To identify potential protein interaction partners of SLC25A41, researchers should implement a multi-method approach:

  • Affinity purification coupled with mass spectrometry (AP-MS): Express tagged SLC25A41 in relevant cell types, perform pull-down experiments, and identify co-purifying proteins by mass spectrometry.

  • Proximity labeling approaches: Utilize BioID or APEX2 fusions with SLC25A41 to biotinylate proteins in close proximity in living cells, followed by streptavidin purification and mass spectrometry.

  • Yeast two-hybrid screening: Use the soluble domains of SLC25A41 as bait to screen for interacting proteins.

  • Co-immunoprecipitation: Validate identified interactions using antibodies against endogenous proteins.

  • FRET or BRET assays: Confirm protein-protein interactions in living cells through fluorescence or bioluminescence resonance energy transfer between tagged proteins.

These approaches should be conducted in mitochondria-relevant contexts, considering the subcellular localization of SLC25A41 in the inner mitochondrial membrane.

What cellular processes might be influenced by SLC25A41 function?

Based on the known roles of other SLC25 family members, SLC25A41 likely influences several critical cellular processes:

  • Energy metabolism: As a mitochondrial carrier, SLC25A41 potentially regulates the exchange of metabolites crucial for energy production, similar to how SLC25A4 controls ADP/ATP exchange .

  • Mitochondrial redox balance: By facilitating substrate transport, it may contribute to maintaining NAD+/NADH ratios across the mitochondrial membrane, similar to the role of SLC25A13 in cancer cells .

  • Metabolic pathway coupling: SLC25A41 could connect cytosolic and mitochondrial metabolic pathways, potentially including the citric acid cycle, similar to the role of SLC25A1 (citrate carrier) .

  • Cell growth and proliferation: Other SLC25 family members influence cancer cell proliferation, suggesting SLC25A41 might also impact cellular growth pathways .

  • Mitochondrial membrane potential maintenance: Through the regulated transport of charged metabolites, it may influence mitochondrial membrane potential, which is critical for mitochondrial function .

What approaches should be used to investigate the potential role of SLC25A41 in disease contexts?

To investigate the potential role of SLC25A41 in disease contexts, researchers should implement a comprehensive strategy:

  • Expression analysis in disease tissues: Quantify SLC25A41 mRNA and protein levels across normal and disease tissues, particularly in cancer samples where other SLC25 members show altered expression .

  • Genetic association studies: Analyze existing genomic databases for associations between SLC25A41 variants and disease phenotypes.

  • Loss and gain of function models: Generate cell lines and animal models with SLC25A41 knockdown, knockout, or overexpression to assess phenotypic consequences.

  • Metabolomic profiling: Compare metabolite profiles in models with altered SLC25A41 expression to identify affected metabolic pathways.

  • Integration with pathophysiological mechanisms: Assess how SLC25A41 dysfunction might contribute to known disease mechanisms such as mitochondrial dysfunction, metabolic reprogramming in cancer, or oxidative stress .

  • Mitochondrial function assays: Measure parameters such as oxygen consumption rate, ATP production, and membrane potential in the context of SLC25A41 manipulation.

These approaches should be integrated with knowledge of mitochondrial biology and the known roles of related carriers in the SLC25 family.

How can researchers develop accurate transport assays for studying SLC25A41 kinetics?

Developing accurate transport assays for SLC25A41 requires addressing several methodological considerations:

  • Liposome preparation optimization:

    • Use defined lipid compositions that mimic the mitochondrial inner membrane

    • Ensure consistent liposome size distribution through extrusion techniques

    • Verify protein incorporation using freeze-fracture electron microscopy or proteoliposome density gradient analysis

  • Substrate selection and labeling:

    • Test multiple potential substrates based on other SLC25 family members

    • Use radioisotope labeling (³H, ¹⁴C) for high sensitivity detection

    • Develop fluorescence-based alternatives with appropriate controls for quenching effects

  • Kinetic assay design:

    • Implement rapid sampling techniques to capture initial rates accurately

    • Utilize robotic systems for consistent timing and temperature control

    • Design concentration matrices with sufficient data points for reliable kinetic model discrimination

  • Data analysis refinement:

    • Apply non-linear regression directly to kinetic equations rather than using transformed plots

    • Use global fitting approaches to analyze multiple datasets simultaneously

    • Implement model selection criteria to distinguish between ping-pong and sequential mechanisms

  • Controls and validation:

    • Include inhibitor studies to confirm specificity of transport

    • Perform counterflow experiments to verify exchange mechanisms

    • Validate with site-directed mutagenesis of predicted substrate-binding residues

What are the key considerations when designing CRISPR/Cas9 gene editing experiments for SLC25A41?

When designing CRISPR/Cas9 gene editing experiments for SLC25A41, researchers should consider:

  • Guide RNA design:

    • Target conserved functional domains identified through sequence alignment with characterized SLC25 family members

    • Select gRNAs with minimal off-target effects using updated prediction algorithms

    • Design multiple gRNAs targeting different exons to increase success probability

  • Editing strategy selection:

    • For knockout studies: target early exons to ensure complete loss of function

    • For knock-in experiments: introduce tags that minimally interfere with protein function

    • For point mutations: design precise donor templates to introduce specific amino acid changes in the substrate-binding site

  • Cellular model selection:

    • Use cell types with relevant mitochondrial biology and detectable SLC25A41 expression

    • Consider conditional systems for essential genes to avoid selection against edited cells

  • Validation approaches:

    • Confirm editing at the genomic level through sequencing

    • Verify protein expression changes by Western blot or immunofluorescence

    • Assess mitochondrial function using respirometry, membrane potential, and metabolite profiling

  • Phenotypic analysis:

    • Measure growth rates under different nutrient conditions

    • Assess metabolic flexibility through substrate utilization tests

    • Evaluate mitochondrial morphology and network dynamics

How does SLC25A41 differ functionally from other mitochondrial carriers in the SLC25 family?

While specific functional data for SLC25A41 is limited in the provided sources, comparative analysis with other SLC25 carriers suggests potential functional distinctions:

  • Substrate specificity differences:

    • Different SLC25 members transport distinct substrates: SLC25A4 (ADP/ATP), SLC25A1 (citrate), SLC25A10 (dicarboxylates), SLC25A11 (oxoglutarate), and SLC25A13 (aspartate/glutamate)

    • SLC25A41 likely has its own substrate preference that contributes to a specific metabolic niche

  • Tissue expression patterns:

    • SLC25 carriers show tissue-specific expression profiles related to metabolic demands

    • SLC25A41's expression pattern may indicate tissues where its transport function is particularly important

  • Regulatory mechanisms:

    • Different carriers respond to distinct regulatory signals; for example, SLC25A13 has calcium-binding domains not present in all family members

    • SLC25A41 may have unique regulatory features that control its activity in response to specific cellular signals

  • Disease associations:

    • Various SLC25 members have distinct roles in disease; some promote cancer progression while others act as tumor suppressors

    • SLC25A41's role in disease contexts likely depends on its specific transport function and expression pattern

  • Oligomeric state:

    • While most SLC25 carriers function as monomers, some like SLC25A13 operate as dimers

    • The oligomeric state of SLC25A41 would influence its functional properties and regulation

What evolutionary insights can be gained from phylogenetic analysis of SLC25A41?

Phylogenetic analysis of SLC25A41 can provide valuable evolutionary insights:

  • Evolutionary conservation:

    • Comparing SLC25A41 sequences across species reveals conserved residues likely critical for function

    • Analysis of conservation patterns in the substrate-binding site could predict substrate specificity

  • Expansion and specialization:

    • The SLC25 family expanded through gene duplication events during evolution

    • SLC25A41's position in the phylogenetic tree indicates when it diverged from other carriers and developed specialized functions

  • Selection pressure analysis:

    • Calculating dN/dS ratios across the protein sequence identifies regions under positive or purifying selection

    • Substrate-binding regions typically show strong conservation, while regulatory domains may exhibit more variability

  • Structural homology:

    • Despite sequence divergence, SLC25 carriers maintain structural conservation in transmembrane domains and substrate-binding sites

    • Homology modeling based on solved structures of other family members can predict SLC25A41's structural features

  • Functional convergence/divergence:

    • Identification of parallel evolutionary adaptations across different branches of the SLC25 family

    • Analysis of co-evolution with metabolic pathways to understand functional specialization

This phylogenetic framework provides context for experimental studies and can guide hypothesis generation regarding SLC25A41's specific functional role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.