Recombinant Human Solute carrier family 25 member 42 (SLC25A42)

Shipped with Ice Packs
In Stock

Description

Introduction to SLC25A42

SLC25A42 is a mitochondrial carrier protein encoded by the SLC25A42 gene located on chromosome 19p13.11 . It facilitates the transport of coenzyme A (CoA) into mitochondria in exchange for intramitochondrial adenine nucleotides and adenosine 3′,5′-diphosphate (PAP) . Recombinant versions of this protein are produced in heterologous expression systems like HEK293 cells for functional studies .

Key Features:

  • Domain Architecture: Three tandem sequence repeats with six transmembrane helices, forming a substrate-binding groove .

  • Substrate Specificity: High affinity for CoA (Km = 8.5 μM), dephospho-CoA, ADP, and PAP .

  • Transport Mechanism: Strict counter-exchange kinetics inhibited by bongkrekic acid .

Table 1: Biochemical Properties of Recombinant SLC25A42

PropertyValue/DetailSource
Molecular Weight~34 kDa (predicted)
Expression SystemHEK293T cells with C-terminal Myc/DDK tag
ReconstitutionPhospholipid vesicles with Triton X-114
Key InhibitorsBongkrekic acid, pyridoxal 5′-phosphate

Expression Systems:

  • HEK293T Cells: Transient transfection yields lysates containing 1 mg/ml protein in RIPA buffer, suitable for Western blot (WB) and immunoprecipitation (IP) .

  • E. coli: Overexpression and purification via Sarkosyl detergent, followed by reconstitution into liposomes for transport assays .

Research Applications:

  • Metabolic Studies: Used to investigate CoA transport deficits in mitochondrial encephalomyopathy .

  • Drug Screening: Evaluates inhibitors targeting mitochondrial carriers .

  • Biomarker Research: Upregulated in placental insufficiency, suggesting fetal metabolic reprogramming .

Disease Associations:

  • Mitochondrial Encephalomyopathy: Linked to biallelic SLC25A42 mutations, presenting with lactic acidosis, dystonia, and basal ganglia lesions .

  • Therapeutic Response: Fibroblasts from patients show CoA level restoration after pantothenic acid treatment .

Table 2: Key Clinical Findings from SLC25A42 Studies

Study FocusMajor FindingsSource
CoA Transport DeficiencyReduced mitochondrial respiration rates in patient fibroblasts
Genetic Variability15 reported cases with Arab ethnicity predominance
Therapeutic InterventionPantothenic acid normalizes CoA levels in vitro

Future Directions

  • Gene Therapy: Rescue experiments using full-length human SLC25A42 in zebrafish morphants show phenotypic reversal .

  • Diagnostic Tools: Transcript levels in blood may serve as biomarkers for placental insufficiency .

  • Structural Studies: Cryo-EM could resolve substrate-binding dynamics to inform drug design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A42; Mitochondrial coenzyme A transporter SLC25A42; Solute carrier family 25 member 42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A42
Target Protein Sequence
MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII FQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGS YYGFRGEALPPWPRLFAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE EGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPYPFERMIFGACAGLIG QSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVG ISFTTFDLMQILLRHLQS
Uniprot No.

Target Background

Function
Mitochondrial carrier mediating the transport of coenzyme A (CoA) in mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.
Gene References Into Functions
  1. Provides a comparative analysis of all known human SLC25A* genes, including functional information. PMID: 23266187
  2. Observational study of gene-disease association. (HuGE Navigator) PMID: 20877624
  3. Clinical trial investigating gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  4. The primary physiological role of SLC25A42 is to import CoA into mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate. PMID: 19429682
Database Links

HGNC: 28380

OMIM: 610823

KEGG: hsa:284439

STRING: 9606.ENSP00000326693

UniGene: Hs.303669

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of SLC25A42 in mitochondrial metabolism?

SLC25A42 functions primarily as a mitochondrial transporter for coenzyme A (CoA) and adenosine 3',5'-diphosphate. Its main physiological role is to import CoA into mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate. This transport is critical because CoA is synthesized outside the mitochondrial matrix but is required inside for numerous fundamental mitochondrial processes. Biochemical characterization has shown that SLC25A42 catalyzes exclusively counter-exchange transport with high affinity for CoA, dephospho-CoA, ADP, and adenosine 3',5'-diphosphate . The protein is saturable and can be inhibited by various compounds including bongkrekic acid, which is known to inhibit mitochondrial carriers .

What is the structural composition of human SLC25A42?

Human SLC25A42, like other members of the solute carrier family 25, is a structural and functional monomer of approximately 300 amino acids. The protein has six transmembrane α-helices arranged in a 3-fold pseudo-symmetrical pattern (consisting of three repeats of two transmembrane helices each). These helices surround a central cavity that forms the substrate binding site . The protein adopts two main conformational states during transport: a cytoplasmic-open state (c-state) and a matrix-open state (m-state). The alternating access between these two states enables the transport mechanism, with conformational changes occurring upon substrate binding at the central cavity . This structural arrangement is highly conserved among SLC25 family transporters and allows for the identification of solute-binding residues and prediction of transported molecules.

How does SLC25A42 interact with other mitochondrial transport systems?

SLC25A42 functions within a complex network of mitochondrial transporters that collectively regulate metabolite flux across the inner mitochondrial membrane. While SLC25A42 specifically handles CoA and adenosine 3',5'-diphosphate transport, its activity is integrated with other transport systems such as the ATP/ADP exchangers (ANTs) that maintain adenylate balance. Research indicates that these transporters do not function in isolation but exhibit genetic interactions that become apparent under specific metabolic conditions . One approach to study these interactions involves dual genetic perturbation strategies that reveal the interdependence of these transport systems. Unlike some redundant transporter families (such as the four ANT proteins), SLC25A42 appears to have a more specialized role that cannot be fully compensated by other transporters, making it particularly important for mitochondrial function .

What are the recommended methods for expressing and purifying recombinant human SLC25A42 for functional studies?

For functional characterization of SLC25A42, a well-established approach involves heterologous expression in Escherichia coli followed by purification and reconstitution into phospholipid vesicles. This methodology has proven successful for biochemical characterization of transport properties and kinetic parameters . The procedure typically involves:

  • Cloning the SLC25A42 gene into an appropriate expression vector (such as pCMV6-AC-GFP for mammalian studies or bacterial expression vectors)

  • Overexpression in E. coli using optimal induction conditions

  • Purification using affinity chromatography, often facilitated by fusion tags

  • Reconstitution into phospholipid vesicles to create proteoliposomes

  • Transport assays using radioactively labeled substrates

For researchers specifically interested in cellular localization and protein-protein interactions, expression-ready ORF plasmids with C-terminal tags (such as tGFP) are commercially available . These enable visualization of the protein in mammalian cell systems and facilitate co-localization studies with other mitochondrial proteins.

What transport assay systems are most effective for measuring SLC25A42 activity?

When studying SLC25A42 transport activity, reconstituted proteoliposome systems represent the gold standard for precise kinetic measurements. In this approach:

  • Purified SLC25A42 is reconstituted into liposomes containing specific phospholipids

  • Transport is initiated by adding external substrate

  • Counter-exchange is measured by monitoring internal substrate release or external substrate uptake

  • Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations

This system allows researchers to determine transport properties including substrate specificity, transport affinity, and inhibitor sensitivity. Studies have demonstrated that SLC25A42 exhibits high transport affinity for CoA, dephospho-CoA, ADP, and adenosine 3',5'-diphosphate, with saturable kinetics . Additionally, the transport activity is inhibited by bongkrekic acid, which can serve as a useful experimental control . Alternative approaches include whole-cell transport assays using radioisotope-labeled substrates in cells overexpressing SLC25A42, though these provide less direct measurements of transport kinetics.

How can CRISPR-based systems be optimized for studying SLC25A42 function in cellular contexts?

CRISPR-based approaches offer powerful tools for investigating SLC25A42 function in cellular contexts. Recent advanced methodologies include:

  • Combinatorial CRISPR screening approaches: Using dual Cas9 enzyme systems with different PAM recognition sequences to generate pair-wise knockouts of multiple SLC25 family members . This approach is particularly valuable for uncovering genetic interactions that might be masked by functional redundancy.

  • Metabolic state-dependent screening: Conducting CRISPR screens under varied metabolic conditions (glucose, galactose, OXPHOS inhibition, absence of pyruvate) to reveal context-dependent functions of SLC25A42 .

  • Gene-by-environment (GxE) interaction discovery: Using combinatorial screens to identify conditions where SLC25A42 knockouts show differential effects depending on the metabolic state of the cell .

Optimal guide RNA design should target conserved functional domains to ensure complete loss of function. For SLC25A42, targeting sequences encoding the substrate binding site residues or transmembrane domains is particularly effective. When designing such experiments, researchers should consider metabolic states that might specifically challenge mitochondrial function to reveal phenotypes that might be masked under standard growth conditions.

How do mutations in SLC25A42 affect its transport kinetics and contribute to mitochondrial encephalomyopathy?

Mutations in SLC25A42 can significantly disrupt its transport function, leading to a specific mitochondrial encephalomyopathy characterized by recurrent encephalopathy, metabolic acidosis, dystonia, lactic acidosis, and basal ganglia lesions . Functional studies of disease-associated mutations reveal their impact on transport kinetics through multiple mechanisms:

  • Reduced protein expression: Certain mutations, particularly deletions, can lead to significantly diminished protein expression levels as demonstrated by immunoblotting experiments .

  • Altered substrate binding: Mutations affecting residues in the central cavity can reduce affinity for CoA and other substrates.

  • Conformational disruption: Mutations may interfere with the alternating-access transport mechanism by destabilizing either the c-state or m-state conformations.

  • Protein instability: Some mutations may affect protein folding and stability, leading to increased degradation and reduced functional transporter in the mitochondrial membrane.

To study these effects, researchers employ site-directed mutagenesis of recombinant SLC25A42 followed by functional reconstitution assays comparing wild-type and mutant transport activities. Additionally, patient-derived cells can be analyzed for CoA transport efficiency and associated metabolic consequences, such as alterations in mitochondrial energy production and CoA-dependent enzymatic activities.

What is the relationship between SLC25A42 function and mitochondrial redox regulation?

The transport function of SLC25A42 has emerging connections to mitochondrial redox regulation, though this relationship requires further investigation. Several lines of evidence suggest important interactions:

  • CoA is essential for the tricarboxylic acid (TCA) cycle and fatty acid oxidation, processes that generate reducing equivalents for the electron transport chain.

  • Genetic interaction studies suggest potential connections between SLC25A42 and other transporters involved in managing oxidative stress. For example, SLC25A39, a potential mitochondrial glutathione transporter, shows genetic interactions with iron transporter SLC25A37 under specific metabolic conditions .

  • The proper balance of CoA-related metabolites impacts mitochondrial redox status through the regulation of NAD+/NADH and NADP+/NADPH ratios.

To investigate these relationships experimentally, researchers can employ redox-sensitive fluorescent probes in cells with SLC25A42 knockdown or overexpression, measure changes in glutathione or thioredoxin system components, and evaluate mitochondrial ROS production under different metabolic conditions. Metabolomic profiling of CoA-related metabolites in conjunction with redox status markers can provide insights into how SLC25A42 activity influences the broader mitochondrial redox network.

How does SLC25A42 function change under different metabolic states?

SLC25A42 function exhibits important context-dependent variations across different metabolic states. Recent combinatorial CRISPR screening approaches have revealed gene-by-environment (GxE) interactions for various mitochondrial transporters . While specific data for SLC25A42 is still emerging, several principles likely apply:

Experimental approaches to study these context-dependent functions include:

  • Metabolic flux analysis using isotope-labeled substrates under different nutrient conditions

  • Comparative proteomics and metabolomics in cells grown in different energy substrates

  • Bioenergetic profiling (oxygen consumption, extracellular acidification) in SLC25A42-deficient cells under various substrate conditions

These approaches can reveal how SLC25A42 activity is regulated in response to changing metabolic demands and identify conditions where its function becomes particularly critical.

What are the clinical manifestations of SLC25A42-associated mitochondrial encephalomyopathy?

SLC25A42-associated mitochondrial encephalomyopathy presents with a distinctive clinical profile that includes:

  • Recurrent encephalopathy with metabolic acidosis

  • Intermittent or persistent dystonia

  • Lactic acidosis

  • Basal ganglia lesions visible on neuroimaging

  • Higher prevalence in patients of Arab ethnicity, suggesting possible founder mutations

This disorder should be included in the differential diagnosis for patients presenting with these symptoms, particularly those with unexplained recurrent encephalopathy with metabolic features. The clinical course may involve episodic exacerbations triggered by metabolic stressors such as fasting, illness, or increased energy demands. Diagnostic approaches include molecular genetic testing, measurement of blood and CSF lactate levels, brain MRI to identify characteristic basal ganglia lesions, and in some cases, muscle biopsy to assess mitochondrial function .

What therapeutic approaches show promise for SLC25A42-associated disorders?

While specific therapies targeting SLC25A42 dysfunction are still in development, several approaches show promise:

  • Deep brain stimulation (DBS): For patients with life-altering dystonia, DBS has been suggested as a management approach that may provide symptomatic relief .

  • Metabolic interventions: Strategies to increase CoA availability or provide alternative energy substrates may help bypass the metabolic consequences of deficient mitochondrial CoA transport.

  • Mitochondrial cocktails: Standard treatments for mitochondrial disorders, including coenzyme Q10, riboflavin, L-carnitine, and other cofactors may provide supportive benefit.

  • Gene therapy approaches: Though still experimental, viral vector-mediated delivery of functional SLC25A42 to affected tissues represents a potential future therapeutic direction.

  • Novel small molecule transport enhancers: Compounds that could enhance the activity of residual SLC25A42 transporters or activate alternative CoA transport mechanisms are theoretical targets for drug development.

Research into these approaches requires appropriate cellular and animal models of SLC25A42 deficiency, which are still being developed and refined. Patient-derived cells, including fibroblasts and induced pluripotent stem cells differentiated into relevant cell types, provide valuable platforms for therapeutic screening.

How can SLC25A42 variants be functionally characterized for clinical interpretation?

Accurate functional characterization of SLC25A42 variants is essential for clinical interpretation and patient management. A comprehensive approach includes:

  • In silico prediction tools: Using computational algorithms to predict the impact of variants on protein structure, stability, and function based on evolutionary conservation and physiochemical properties.

  • Recombinant protein studies: Expressing variant proteins in heterologous systems to assess:

    • Protein expression and stability

    • Subcellular localization

    • Transport kinetics for CoA and other substrates

    • Response to inhibitors

  • Patient-derived cell studies:

    • Measurement of mitochondrial CoA content

    • Assessment of CoA-dependent metabolic pathways

    • Complementation studies with wild-type SLC25A42

  • Population data integration: Evaluating variant frequency in population databases and segregation in affected families.

A classification system similar to that used for other genetic disorders (pathogenic, likely pathogenic, uncertain significance, likely benign, benign) can be applied based on the combined evidence. For novel variants, functional studies are particularly important to establish pathogenicity and potential genotype-phenotype correlations.

What bioinformatic approaches are most useful for analyzing SLC25A42 in multi-omics datasets?

Integrated multi-omics analysis of SLC25A42 requires specialized bioinformatic approaches:

  • Comparative genomics: Analyzing evolutionary conservation of SLC25A42 across species can identify functionally critical residues and domains. Alignment with other SLC25 family members helps distinguish shared vs. unique features.

  • Structural bioinformatics: Homology modeling based on the known structures of related transporters (particularly ANT crystal structures) can predict the impact of variants and guide experimental design .

  • Expression correlation networks: Identifying genes whose expression correlates with SLC25A42 across tissues or experimental conditions can reveal functional associations and regulatory relationships.

  • Metabolomic data integration: Correlating SLC25A42 expression or genetic variation with CoA-related metabolites and broader metabolomic profiles.

  • Pathway enrichment analysis: Determining which metabolic pathways are most affected by SLC25A42 perturbation through integration of transcriptomic and proteomic data.

For researchers with limited bioinformatics expertise, several resources are available including the SLC TABLES database, MitoCarta for mitochondrial protein analysis, and various metabolic pathway analysis tools that incorporate transport functions. When analyzing multi-omics data, particular attention should be paid to metabolic state dependencies that might influence SLC25A42 function or its relationships with other cellular components.

How should researchers interpret contradictory data regarding SLC25A42 function or interactions?

When faced with contradictory data regarding SLC25A42 function or interactions, researchers should implement a systematic evaluation approach:

  • Experimental context analysis: Carefully examine differences in:

    • Cell or tissue types used (different metabolic requirements)

    • Experimental conditions (nutrients, oxygen tension, confluency)

    • Methodological approaches (in vitro transport vs. cellular phenotypes)

  • Genetic background considerations: Evaluate whether:

    • Compensatory mechanisms exist in certain genetic backgrounds

    • Additional genetic variants influence SLC25A42 function

    • Expression levels of interacting partners differ between systems

  • Technical validation: Assess whether:

    • Different antibodies or detection methods yield consistent results

    • Controls adequately account for potential artifacts

    • Statistical analyses are appropriate for the experimental design

  • Metabolic state dependency: Consider how:

    • Different energy substrates might alter transporter requirements

    • Cellular stress responses might modify SLC25A42 function

    • Adaptive responses might mask acute phenotypes

What emerging technologies are advancing our understanding of SLC25A42 dynamics and regulation?

Several cutting-edge technologies are transforming SLC25A42 research:

  • Cryo-electron microscopy (cryo-EM): While the SLC25A42 structure has not yet been solved at high resolution, advances in cryo-EM are enabling structural determination of membrane transporters in different conformational states. This technology could reveal the structural basis of the alternating-access mechanism and substrate recognition .

  • Live-cell metabolite imaging: Fluorescent sensors for CoA and related metabolites enable real-time visualization of metabolite dynamics in conjunction with SLC25A42 activity in living cells.

  • Genome-wide CRISPR screens under defined metabolic states: As demonstrated in recent research, comprehensive genetic interaction mapping under different metabolic conditions can reveal context-dependent functions and genetic interactions of SLC25A42 .

  • Mitochondria-targeted proteomics: Proximity labeling approaches (BioID, APEX) coupled with mass spectrometry enable identification of SLC25A42 interaction partners within the native mitochondrial environment.

  • Single-cell multi-omics: These approaches can reveal cell-to-cell variability in SLC25A42 expression and function, particularly relevant for understanding heterogeneous manifestations in disease states.

These technologies are transforming our understanding of SLC25A42 from a static transporter to a dynamically regulated component of mitochondrial metabolism that responds to and influences the broader metabolic network of the cell.

What model systems best recapitulate human SLC25A42 function for in-depth studies?

Selecting appropriate model systems for SLC25A42 research requires careful consideration of research objectives:

  • Cell culture models:

    • Human cell lines with CRISPR-engineered SLC25A42 modifications

    • Patient-derived fibroblasts or lymphoblasts

    • iPSC-derived neurons or myocytes for tissue-specific effects

  • Reconstitution systems:

    • Proteoliposomes with purified recombinant SLC25A42

    • Nanodiscs for structural and single-molecule studies

    • Planar lipid bilayers for electrophysiological measurements

  • Animal models:

    • Mouse models with conditional Slc25a42 knockout

    • Zebrafish models for developmental and neurological phenotypes

    • Drosophila for high-throughput genetic interaction studies

  • Organoid systems:

    • Brain organoids to study neurological manifestations

    • Liver organoids for metabolic phenotypes

Each system offers distinct advantages: cell lines provide accessibility and ease of genetic manipulation; reconstitution systems offer precise control over experimental variables; animal models capture systemic interactions; and organoids bridge the gap between simple cellular models and complex in vivo systems. The choice of model should be guided by the specific research question, with an awareness of the limitations of each system in recapitulating human SLC25A42 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.