Recombinant Human Solute carrier family 25 member 44 (SLC25A44)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Metabolism

SLC25A44 is a mitochondrial carrier protein with two established roles:

  1. Branched-Chain Amino Acid (BCAA) Transport:

    • Facilitates mitochondrial uptake of BCAAs (valine, leucine, isoleucine) for oxidation, critical for thermogenesis in brown adipose tissue (BAT) .

    • BAT-specific knockout (KO) mice show impaired BCAA clearance, reduced thermogenesis, and increased susceptibility to diet-induced obesity .

  2. Secondary Metabolite Transport:

    • Transports precursors like para-coumaric acid, cinnamic acid, and 4-aminobenzoic acid into mitochondria, supporting ubiquinone biosynthesis and electron transport chain (ETC) activity .

3.1. Thermogenesis and Energy Homeostasis

  • Cold Exposure: BAT upregulates SLC25A44 to enhance BCAA oxidation, improving systemic BCAA clearance in mice and humans .

  • Fever Response: Prostaglandin E₂ (PGE₂) and psychological stress increase mitochondrial BCAA oxidation in BAT via SLC25A44, which is essential for non-shivering thermogenesis .

  • Mechanistic Insight: SLC25A44-deficient BAT exhibits reduced TCA cycle intermediates and amino acid synthesis, impairing metabolic flexibility .

3.2. Evolutionary Conservation and Disease Links

  • Phylogenetic Analysis: SLC25A44 clusters with ETC-associated transporters (e.g., SLC25A26, A28) and is conserved across eukaryotes, underscoring its role in oxidative phosphorylation .

  • Human Health:

    • Reduced SLC25A44 activity correlates with mitochondrial disorders in brain, kidney, and liver .

    • COSMIC database reports somatic mutations in SLC25A44 linked to cancer, though functional impacts remain under investigation .

Experimental Models and Validation

  • Xenopus Oocyte Assays: SLC25A44 expression increases mitochondrial uptake of para-coumaric acid (14%), cinnamic acid (35%), and 4-aminobenzoic acid (20%) compared to controls .

  • Yeast Complementation: SLC25A44 expression rescues growth defects in yeast, confirming its role in sustaining ETC efficiency .

  • Human Cell Studies: CRISPRi-mediated knockdown in brown adipocytes reduces BCAA-driven oxygen consumption rates (OCR) by 30–40% .

Applications in Research

Recombinant SLC25A44 lysate is used to:

  • Standardize assays detecting endogenous SLC25A44 in human tissues .

  • Investigate mitochondrial transport mechanisms via in vitro reconstitution .

  • Screen inhibitors or activators targeting BCAA metabolism in metabolic diseases .

Future Directions

Current research gaps include elucidating SLC25A44’s substrate specificity and regulatory interactions with FOXK transcription factors, which may link mitochondrial metabolism to glycolytic pathways . Clinical trials targeting SLC25A44 could offer therapeutic strategies for obesity, diabetes, and mitochondrial disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A44; KIAA0446; Solute carrier family 25 member 44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A44
Target Protein Sequence
MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDA FIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSAS LVAQSITVPIDVVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLR GFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSYLCPKECPHIVFQAVSGPLAAATASILT NPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLK KLSLRPELVDSRHW
Uniprot No.

Target Background

Function
Mitochondrial solute transporter responsible for transporting branched-chain amino acids (BCAAs; valine, leucine, and isoleucine) into mitochondria in brown adipose tissue (BAT). BAT plays a role in BCAA catabolism and actively utilizes BCAAs in the mitochondria for thermogenesis.
Database Links

HGNC: 29036

OMIM: 610824

KEGG: hsa:9673

STRING: 9606.ENSP00000352497

UniGene: Hs.532375

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is SLC25A44 and what is its primary function?

SLC25A44 belongs to the solute carrier family 25 (SLC25), a group of membrane transporters present exclusively in eukaryotes. It functions primarily as a transporter for common precursors of ubiquinone and secondary metabolites such as flavonoids and stilbenoids . As a member of the mitochondrial carrier family, SLC25A44 plays a key role in energy metabolism by facilitating the transport of metabolites between cellular compartments .

Experimental evidence confirms that SLC25A44 acts as an importer for several important metabolic precursors, including para-coumaric acid, cinnamic acid, and 4-aminobenzoic acid . These compounds serve as essential building blocks for the biosynthesis of ubiquinone (Coenzyme Q), which functions as an electron shuttle in the mitochondrial electron transfer chain (ETC) .

Where is SLC25A44 localized within the cell?

SLC25A44 exhibits a multi-compartmental localization pattern. Despite its classification as a mitochondrial carrier, research has demonstrated that SLC25A44 is not restricted to mitochondria alone. Both human SLC25A44 and its orthologs (such as AdSLC25A44) have been localized to:

  • Mitochondrial membranes

  • Endoplasmic reticulum (ER) membranes

  • Nuclear membranes

This multi-compartmental distribution was confirmed through subcellular localization studies using GFP-fusion proteins in Saccharomyces cerevisiae. The observed localization pattern resembles that of previously characterized yeast mitochondrial, ER, and nuclear membrane proteins such as CTP1, OXA1, YHM2, APQ12, ERD2, and BRR1 .

What metabolites does SLC25A44 transport?

SLC25A44 demonstrates transport activity for several important metabolic intermediates:

MetaboliteTransport DirectionRelative Transport ActivityStatistical Significance
Para-coumaric acidImport14% increase compared to controlp = 9.6 × 10⁻³
Cinnamic acidImport35% increase compared to controlp = 5.4 × 10⁻³
4-aminobenzoic acidImport20% increase compared to controlp = 2.7 × 10⁻³
ResveratrolImportNo significant activityNot significant
Para-coumaric acidExportNo significant activityNot significant
ResveratrolExportNo significant activityNot significant

These transport activities were determined using Xenopus laevis oocytes expressing recombinant SLC25A44 . The absence of export activity might be attributed to the lack of a co-substrate in the experimental buffer and the likely antiport mechanism of SLC25A44, which is common among SLC25 family members .

What is the expression pattern of SLC25A44 in different tissues?

SLC25A44 exhibits a ubiquitous expression pattern across various tissues, consistent with its role as an essential housekeeping gene. In humans, SLC25A44 shows particularly high expression levels in brain, kidney, and liver tissues . These organs are known to be highly sensitive to mitochondrial disorders and have the highest resting metabolic rates, underscoring the critical role of SLC25A44 in energy metabolism .

In Arabidopsis thaliana, SLC25A44 demonstrates constitutive expression at levels comparable to established housekeeping genes such as Ubc9 and Gapdh across hundreds of different conditions and tissues . This consistent expression pattern further supports the classification of SLC25A44 as an essential housekeeping gene.

How conserved is SLC25A44 across species?

SLC25A44 exhibits remarkable conservation at both the intra-species and inter-species levels. The high degree of conservation reflects its essential function and the strong purifying selection pressure it has experienced during evolution. Key evidence includes:

  • Intra-species conservation: Human SLC25A44 shows very limited polymorphism, with only 3% of variants occurring within coding regions, and less than 0.8% being missense variants (all present as very low-frequency, heterozygous-only SNPs)

  • Arabidopsis thaliana SLC25A44 shows no missense mutations across different lines of this self-fertilizing homozygote plant

  • Inter-species conservation: SLC25A44 orthologs from 129 vertebrate species exhibit a non-synonymous/synonymous substitution rate ratio of only 0.0528 (Log(L) = −22,531), indicating strong purifying selection

  • Only one amino acid site shows asymptotic diversification with a p-value of 0.01

This high degree of conservation underscores the essential nature of SLC25A44 in higher eukaryotes and suggests that mutations affecting its function might be incompatible with life.

What experimental approaches can be used to characterize the transport activity of recombinant SLC25A44?

Characterizing the transport activity of recombinant SLC25A44 requires robust experimental systems that allow for the expression, localization, and functional analysis of the protein. Based on published research, the following methodological approaches have proven effective:

Xenopus laevis Oocyte Expression System

The Xenopus oocyte system provides an excellent platform for studying transport proteins due to their high translational capacity and large size. For SLC25A44 characterization:

  • Expression: mRNA encoding SLC25A44 is injected into oocytes, allowing for heterologous expression of the protein. This approach has been successfully employed for AdSLC25A44 .

  • Import Assay: Oocytes expressing SLC25A44 are incubated in a buffer (e.g., Kulori buffer) containing potential substrates at defined concentrations (typically 0.2 mM). After incubation, oocytes are washed, lysed, and the intracellular accumulation of substrates is quantified using appropriate analytical methods (HPLC, LC-MS) .

  • Export Assay: Potential substrates are directly injected into oocytes expressing SLC25A44 to a final intracellular concentration (approximately 2 mM). After incubation, the external buffer is analyzed for the presence of exported compounds .

  • Controls: Oocytes injected with water or unrelated mRNA serve as negative controls to establish baseline transport levels .

Yeast Expression Systems

Saccharomyces cerevisiae provides a eukaryotic expression system with advantages for studying mitochondrial transporters:

  • Strain Construction: Specialized yeast strains can be engineered to produce metabolites of interest by introducing relevant biosynthetic genes (e.g., PAL and TAL strains for para-coumaric acid production) .

  • Expression Vectors: SLC25A44 can be expressed using appropriate vectors, with optional tags (e.g., GFP) for localization studies .

  • Growth Analysis: The impact of SLC25A44 expression on yeast growth provides insights into its physiological role .

  • Metabolite Analysis: Extracellular and intracellular metabolites can be quantified to assess the impact of SLC25A44 expression on metabolic flux .

What is the structural significance of the conserved three-amino acid signature in SLC25A44?

SLC25A44 proteins contain a highly conserved three-amino acid signature (V/I/L/AWW) that is crucial for their function and specificity. This signature has several important characteristics:

  • Location: The signature is situated on the cytosolic face of the transport cavity, specifically at the C-terminal end of transmembrane helix 4 .

  • Phylogenetic Distinction: This signature is distinguishable among the phylogenetic sub-clusters of the ETC-clade of SLC25 transporters, making it a promising motif for transport engineering .

  • Functional Implications: The conserved signature likely plays a role in substrate recognition and transport specificity, given its location within the transport cavity. The presence of aromatic residues (tryptophan) suggests potential involvement in π-π interactions with aromatic substrates like para-coumaric acid and cinnamic acid .

  • Engineering Potential: The distinctive nature of this signature across different SLC25 subfamilies makes it a promising target for rational engineering approaches aimed at altering substrate specificity or transport efficiency .

Researchers investigating this signature should consider site-directed mutagenesis approaches combined with functional assays to elucidate its precise role in substrate recognition and transport.

How does SLC25A44 contribute to mitochondrial energy metabolism?

SLC25A44 plays a pivotal role in mitochondrial energy metabolism primarily through its function in transporting precursors required for ubiquinone biosynthesis. The relationship between SLC25A44 and energy metabolism is supported by multiple lines of evidence:

  • Ubiquinone Precursor Transport: SLC25A44 transports hydroxybenzoic acid and aminobenzoic acid, which are essential precursors for ubiquinone biosynthesis . Ubiquinone (Coenzyme Q) serves as an electron shuttle from complexes I and II toward complex III of the electron transport chain, making it indispensable for oxidative phosphorylation .

  • Co-localization with ETC Genes: SLC25A44 is genomically co-localized with genes coding for mitochondrial electron transfer chain subunits across multiple species, including ubiquinone oxidoreductases and mitochondrial complex I subunit NDUFA12 . This genomic arrangement suggests coordinated regulation and functional relationship.

  • Impact on Oxidative Phosphorylation: Down-regulation of SLC25A44 orthologs in model organisms like Trypanosoma brucei and Caenorhabditis elegans leads to reduced oxidative phosphorylation, lower ATP levels, growth arrest, and eventually death .

  • Growth Enhancement: Expression of SLC25A44 in Saccharomyces cerevisiae improves growth rate, consistent with enhanced energy metabolism efficiency .

  • Co-expression with Metabolic Regulators: SLC25A44 is co-expressed with FOXK transcriptional regulators in mouse and human, potentially to improve ETC efficiency when glycolytic intermediates are primarily utilized for anabolic reactions . FOXK1 and FOXK2 favor aerobic glycolysis by uncoupling glycolysis from oxidative phosphorylation .

Researchers studying SLC25A44's role in energy metabolism should consider measuring key parameters such as oxygen consumption rates, ATP production, mitochondrial membrane potential, and the activity of individual ETC complexes in models with modulated SLC25A44 expression levels.

What genomic co-localization patterns exist for SLC25A44 and what do they reveal about its function?

Genomic co-localization analysis reveals interesting patterns for SLC25A44 across different species, providing valuable insights into its functional associations:

Plant Species Co-localization Patterns

In peanut (Arachis hypogaea) and its diploid ancestors (A. duranensis and A. ipaensis), SLC25A44 is co-localized with:

  • Resveratrol synthases and chalcone synthases (secondary metabolite pathway genes)

  • Mitochondrial complex I subunit NDUFA12

  • Quinone oxidoreductases

In grape (Vitis vinifera) and species from Fabaceae, Cucurbitaceae, and Rosaceae families, SLC25A44 co-localizes only with genes coding for mitochondrial ETC subunits .

No similar genomic arrangements were observed in Oryza sativa, Gossypium hirsutum, Arabidopsis thaliana, Brassica oleracea, and Capsella rubella .

Animal Species Co-localization Patterns

Among nine examined animal species, SLC25A44 was found adjacent to the mitochondrial complex III subunit UQCRQ coding gene only in the insect Halyomorpha halys .

The variable co-localization patterns across species highlight the convergent evolution of these genomic arrangements, with different combinations of genes implicated in the same metabolic pathway appearing in different lineages .

Functional Implications

These co-localization patterns suggest:

  • SLC25A44 likely functions as a link between primary energy metabolism and secondary metabolite biosynthesis

  • Genomic co-localization facilitates co-inheritance of genes involved in related metabolic functions, providing a selective advantage

  • The existence of co-localization with both ETC components and secondary metabolite genes supports SLC25A44's role in transporting common precursors for both pathways

Researchers can leverage these co-localization patterns to predict potential substrates and functional associations of SLC25A44 in different species.

How can SLC25A44 be engineered for biotechnological applications?

The structural and functional characteristics of SLC25A44 present several opportunities for biotechnological engineering:

Engineering Approaches

  • Signature Motif Modification: The conserved three-amino acid signature (V/I/L/AWW) represents a promising target for rational engineering to alter substrate specificity or transport efficiency . Site-directed mutagenesis of this motif could potentially generate variants with enhanced transport capabilities for specific metabolites.

  • Heterologous Expression Systems: Optimized expression of SLC25A44 in production hosts like Saccharomyces cerevisiae could enhance the biosynthesis of valuable compounds by improving precursor availability .

  • Fusion Proteins: Creating fusion proteins that combine SLC25A44 with other transporters or enzymes could potentially create novel metabolic channels or improve localization to specific cellular compartments.

Potential Applications

  • Secondary Metabolite Production: Engineered SLC25A44 variants could enhance the production of valuable plant-derived compounds such as:

    • Flavonoids and stilbenoids with pharmaceutical properties

    • Resveratrol and other antioxidants

    • Phenylpropanoid derivatives

  • Improving Bioenergy Production: Enhancing ubiquinone biosynthesis through optimized SLC25A44 activity could potentially improve electron transport efficiency in bioenergy applications.

  • Metabolic Engineering: SLC25A44 could be incorporated into synthetic metabolic pathways to facilitate the transport of intermediates between cellular compartments, potentially resolving bottlenecks in engineered biosynthetic pathways.

Researchers pursuing biotechnological applications should consider combining structural analysis, molecular dynamics simulations, and high-throughput screening approaches to identify and characterize SLC25A44 variants with enhanced or altered transport properties.

How can one design experiments to investigate SLC25A44 transport kinetics?

Designing experiments to comprehensively characterize SLC25A44 transport kinetics requires systematic approaches that address various aspects of transporter function:

Substrate Concentration Dependence

To determine key kinetic parameters (Km, Vmax):

  • Utilize the Xenopus oocyte system with SLC25A44 expression

  • Conduct import assays with varying concentrations of substrates (para-coumaric acid, cinnamic acid, 4-aminobenzoic acid)

  • Measure initial rates of transport at each concentration

  • Fit data to appropriate kinetic models (Michaelis-Menten, Hill equation) to determine Km and Vmax values

Transport Mechanism Investigation

To determine if SLC25A44 functions as an antiporter (requiring counter-transport of another substrate):

  • Preload oocytes with potential counter-substrates

  • Measure the impact on import of known SLC25A44 substrates

  • Alternatively, establish proteoliposome systems with purified SLC25A44 to directly measure exchange of substrates across the membrane

pH and Membrane Potential Dependence

Considering SLC25A44's localization to multiple membrane systems:

  • Conduct transport assays at different pH values to determine optimal conditions and potential proton coupling

  • Use membrane potential modulators to assess voltage-dependence of transport

  • Compare kinetics across different membrane systems (mitochondrial, ER, nuclear) to understand contextual differences in transport function

What approaches can be used to investigate the impact of SLC25A44 mutations on cellular function?

Given the essential nature of SLC25A44 and its high conservation across species, investigating the impact of mutations requires carefully designed experimental approaches:

Conditional Knockout Systems

To overcome the potential lethality of complete SLC25A44 inactivation:

  • Generate conditional knockout models using Cre-lox or similar systems

  • Establish inducible shRNA or CRISPR interference systems for temporal control of knockdown

  • Monitor phenotypic changes including:

    • Cellular respiration rates

    • Mitochondrial membrane potential

    • ATP production

    • Ubiquinone levels

    • Secondary metabolite profiles

Structure-Function Analysis

To understand the impact of specific mutations:

  • Generate point mutations in the conserved three-amino acid signature (V/I/L/AWW)

  • Create chimeric proteins between SLC25A44 and related transporters

  • Express mutant variants in Xenopus oocytes and yeast systems to assess functional changes

  • Combine with computational modeling to predict structural impacts

Cellular Stress Response

To characterize the cellular consequences of SLC25A44 dysfunction:

  • Monitor mitochondrial morphology and dynamics

  • Assess reactive oxygen species (ROS) production

  • Measure activation of mitochondrial unfolded protein response (UPRmt)

  • Evaluate changes in expression of related metabolic genes

How should researchers interpret conflicting data regarding SLC25A44 function?

When faced with conflicting experimental results regarding SLC25A44 function, researchers should consider several potential explanations and follow a systematic approach to resolution:

Context-Dependent Functions

SLC25A44 localizes to multiple cellular compartments (mitochondria, ER, and nucleus) and may exhibit different functions in each context:

  • Compare subcellular localization across experimental systems

  • Assess potential post-translational modifications affecting localization or function

  • Consider the influence of cell type-specific factors on SLC25A44 activity

Methodological Considerations

Different experimental approaches may reveal different aspects of SLC25A44 function:

  • Expression Systems: Results from Xenopus oocytes, yeast, and mammalian cell systems may differ due to variations in membrane composition, post-translational processing, or the presence of endogenous transporters

  • Transport Assays: Compare direct transport measurements with indirect metabolic impacts:

    • Import vs. export capabilities

    • Presence of necessary co-substrates for antiport activity

    • Time-dependent changes in transport activity

  • Substrate Specificity: Confirm substrate identity using multiple analytical methods and standards

Evolutionary Considerations

SLC25A44 function may vary across species due to evolutionary divergence:

  • Compare sequence conservation in functionally important regions

  • Assess genomic context and co-localization patterns

  • Consider the presence of functional paralogs or compensatory mechanisms

How can researchers integrate SLC25A44 data with broader metabolic pathways?

Integrating SLC25A44 function into broader metabolic networks requires multifaceted approaches:

Metabolic Flux Analysis

  • Conduct isotope tracing experiments to track the movement of labeled precursors in cells with normal vs. altered SLC25A44 expression

  • Measure flux through:

    • Ubiquinone biosynthetic pathway

    • Flavonoid and stilbenoid pathways

    • Mitochondrial electron transport chain

Multi-omics Integration

Combine multiple data types to build comprehensive models:

  • Transcriptomics: Identify co-expressed genes and potential regulatory relationships

  • Proteomics: Map protein-protein interactions and post-translational modifications

  • Metabolomics: Characterize changes in metabolite pools affected by SLC25A44 activity

  • Network Analysis: Utilize pathway enrichment and network analysis to identify key nodes connecting SLC25A44 to broader cellular functions

Systems Biology Modeling

Develop computational models incorporating SLC25A44 transport kinetics:

  • Create ordinary differential equation (ODE) models of relevant metabolic pathways

  • Incorporate SLC25A44 transport parameters

  • Validate model predictions with experimental data

  • Use models to predict metabolic responses to perturbations in SLC25A44 activity

What are the implications of SLC25A44 research for understanding mitochondrial disorders?

SLC25A44's essential role in transporting ubiquinone precursors has significant implications for understanding and potentially treating mitochondrial disorders:

Clinical Relevance

  • SLC25A44 dysfunction could potentially contribute to mitochondrial disorders characterized by:

    • Reduced oxidative phosphorylation

    • Decreased ATP production

    • Increased oxidative stress

    • Tissue-specific energy deficiencies

  • The high expression of SLC25A44 in brain, kidney, and liver correlates with the organs most sensitive to mitochondrial disorders and those with the highest resting metabolic rates

Potential Biomarkers

Changes in SLC25A44 function or expression could serve as biomarkers for mitochondrial dysfunction:

  • Altered transport of metabolic precursors

  • Changes in ubiquinone levels or biosynthetic intermediates

  • Compensatory changes in expression of related transporters

Therapeutic Strategies

Understanding SLC25A44 function opens potential therapeutic avenues:

  • Bypassing transport defects by delivering ubiquinone precursors directly to mitochondria

  • Enhancing residual SLC25A44 activity in partial deficiencies

  • Identifying alternative transport pathways that could be upregulated to compensate for SLC25A44 dysfunction

How can SLC25A44 research contribute to metabolic engineering of high-value compounds?

SLC25A44's role in transporting precursors for both ubiquinone and secondary metabolites presents opportunities for metabolic engineering applications:

Improving Production of Plant Secondary Metabolites

  • Enhance flavonoid and stilbenoid production by optimizing precursor availability through SLC25A44 engineering

  • Develop yeast or bacterial production systems with optimized SLC25A44 expression for:

    • Resveratrol production

    • Para-coumaric acid-derived compounds

    • Other phenylpropanoid derivatives with pharmaceutical value

Balancing Primary and Secondary Metabolism

  • Utilize SLC25A44's dual role in energy metabolism and secondary metabolite production to develop balanced production systems

  • Design dynamic regulatory systems that adjust SLC25A44 activity based on cellular energetic status

  • Optimize the distribution of precursors between ubiquinone and secondary metabolite pathways

Compartmentalization Strategies

Leverage SLC25A44's multi-compartmental localization:

  • Engineer organelle-specific variants to direct precursor transport to desired cellular locations

  • Create synthetic metabolic channels by coupling SLC25A44 with biosynthetic enzymes

  • Establish metabolic segregation to prevent unwanted side reactions or product degradation

What emerging technologies could advance SLC25A44 research?

Several cutting-edge technologies show promise for deepening our understanding of SLC25A44 function:

Structural Biology Approaches

  • Cryo-EM Analysis: Determine high-resolution structures of SLC25A44 in different conformational states to understand the transport mechanism

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Map conformational changes associated with substrate binding and transport

  • Single-Molecule FRET: Monitor real-time conformational changes during transport cycles

Genome Editing Technologies

  • Base Editing and Prime Editing: Introduce precise mutations in the SLC25A44 gene to study structure-function relationships

  • CRISPR Activation/Interference: Modulate SLC25A44 expression in a tissue-specific or temporal manner

  • Knock-in Reporter Systems: Tag endogenous SLC25A44 to monitor expression, localization, and protein interactions under physiological conditions

Advanced Imaging Techniques

  • Super-Resolution Microscopy: Visualize SLC25A44 distribution and dynamics at nanoscale resolution

  • Correlative Light and Electron Microscopy (CLEM): Connect SLC25A44 localization with ultrastructural context

  • Proximity Labeling Approaches: Identify proteins in the vicinity of SLC25A44 in different cellular compartments

What are the key unanswered questions about SLC25A44?

Despite significant advances in understanding SLC25A44, several important questions remain unanswered:

Transport Mechanism

  • Does SLC25A44 function as an antiporter, and if so, what are the counter-transported substrates?

  • What is the exact binding site for different substrates, and how does substrate recognition occur?

  • How is transport activity regulated in response to metabolic demands?

Physiological Roles

  • How does SLC25A44 coordinate its functions across different cellular compartments (mitochondria, ER, nucleus)?

  • What is the significance of SLC25A44's co-expression with FOXK transcriptional regulators?

  • Are there tissue-specific functions of SLC25A44 beyond its role in ubiquinone precursor transport?

Evolutionary Aspects

  • How did SLC25A44 evolve to transport precursors for both primary and secondary metabolism?

  • Why do genomic co-localization patterns for SLC25A44 vary across species?

  • What evolutionary pressures have maintained the high conservation of SLC25A44?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.