Recombinant Human Solute carrier family 25 member 47 (SLC25A47)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Research

Key Roles in Mitochondrial Metabolism

  • Substrate Transport: Suspected to mediate mitochondrial pyruvate and malate flux, impacting gluconeogenesis .

  • Energy Homeostasis: Loss of SLC25A47 in mice reduces hepatic mitochondrial respiration, lowers fasting glucose, and increases energy expenditure via FGF21 signaling .

  • Pathway Regulation: Depletion restricts lactate-derived gluconeogenesis by impairing mitochondrial pyruvate conversion to malate .

Experimental Models and Findings

Model SystemKey Observations
Slc25a47<sup>−/−</sup> Mice- Elevated hepatic FGF21 expression
- Reduced body weight and improved insulin sensitivity
- Mitochondrial malate accumulation
Acute Depletion (AAV-Cre)- 50% reduction in SLC25A47 improves pyruvate tolerance without liver fibrosis
Human GWAS DataSNPs in SLC25A47 correlate with lower fasting glucose and HbA1c levels

Clinical and Therapeutic Implications

Metabolic Disease Connections

  • Diabetes: Partial SLC25A47 inhibition reduces gluconeogenesis, suggesting therapeutic potential for hyperglycemia .

  • Hepatic Fibrosis: Chronic deletion in mice induces lipid accumulation and fibrosis, but acute inhibition avoids these effects .

  • Mitochondrial Stress: SLC25A47 loss activates the mitochondrial stress response (MSR), altering systemic metabolism .

Therapeutic Challenges

  • Tissue Specificity: Liver-restricted expression reduces off-target risks but complicates drug delivery .

  • Dose Dependency: Chronic vs. acute inhibition outcomes highlight the need for precise targeting .

Research Gaps and Future Directions

  • Substrate Identification: The exact metabolites transported by SLC25A47 remain unconfirmed .

  • Mechanistic Links: How mitochondrial malate accumulation modulates FGF21 transcription is unclear .

  • Pharmacological Tools: Small-molecule inhibitors or antisense oligonucleotides are under exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of that tag.
Synonyms
SLC25A47; C14orf68; HDMCP; HMFN1655; Solute carrier family 25 member 47; Hepatocellular carcinoma down-regulated mitochondrial carrier protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A47
Target Protein Sequence
MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDTYHRERVWGFYRGLSLPV CTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAK VRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYK GSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDV IKSRLQADGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVL RLARGLLT
Uniprot No.

Target Background

Function
Uncoupling protein potentially involved in catalyzing the physiological 'proton leak' in liver. Overexpression leads to dissipation of mitochondrial membrane potential.
Gene References Into Functions
  1. Compares and contrasts all known human SLC25A* genes, including functional information. PMID: 23266187
  2. Observational study of gene-disease association. (HuGE Navigator) PMID: 20877624
  3. Hepatocellular carcinoma down-regulated mitochondrial carrier protein is a novel liver-specific uncoupling protein PMID: 15322095
  4. HDMCP may function by promoting ATP depletion and decreasing H(2)O(2) production. PMID: 19303656
Database Links

HGNC: 20115

OMIM: 609911

KEGG: hsa:283600

STRING: 9606.ENSP00000354886

UniGene: Hs.108268

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in liver.

Q&A

What is SLC25A47 and what distinguishes it from other mitochondrial transporters?

SLC25A47 is a member of the SLC25A family of mitochondrial carrier proteins localized to the inner mitochondrial membrane. Unlike most SLC25A family members which are ubiquitously expressed across mammalian tissues, SLC25A47 is selectively expressed in the liver, making it uniquely specific to hepatic metabolism . This tissue specificity makes it particularly interesting as a potential therapeutic target for liver-specific metabolic interventions. SLC25A47 appears to be involved in mitochondrial malate export and pyruvate flux, playing a crucial role in hepatic gluconeogenesis, particularly under fasted conditions .

How is SLC25A47 expression regulated at the transcriptional level?

SLC25A47 is a PPARα-regulated gene in both human and mouse hepatocytes. Analysis of multiple independent datasets revealed that SLC25A47 is consistently induced by PPARα activation in human primary hepatocytes, human liver slices, and human hepatoma cells when treated with PPARα agonists like Wy14643 or GW7647 . Chromatin immunoprecipitation sequencing (ChIP-seq) data has identified several PPARα binding sites immediately upstream of the transcriptional start site of SLC25A47, suggesting it is a direct PPARα target gene . This regulation connects SLC25A47 to the broader network of genes involved in fatty acid metabolism and mitochondrial function that are controlled by PPARα.

What metabolic phenotypes are observed in SLC25A47-deficient models?

Several metabolic phenotypes have been observed in SLC25A47-deficient models:

  • Improved glucose tolerance: SLC25A47-deficient mice exhibit significantly improved glucose tolerance compared to wild-type mice, particularly when challenged with a high-fat diet (HFD) .

  • Reduced fasting serum glucose levels: Acute depletion of SLC25A47 results in lower fasting serum glucose levels, consistent with reduced hepatic gluconeogenesis .

  • Enhanced insulin sensitivity: Both acute depletion and genetic knockout models show improved systemic insulin tolerance .

  • Increased FGF21 levels: SLC25A47 depletion leads to elevated hepatic FGF21 mRNA expression and increased serum FGF21 levels, which may contribute to the improved metabolic phenotype .

  • Altered TCA cycle intermediates: Metabolomic analyses reveal changes in TCA cycle intermediates in the plasma of SLC25A47-deficient mice, with elevated levels of α-ketoglutaric acid, malic acid, fumaric acid, and other related metabolites .

What is the molecular mechanism by which SLC25A47 influences hepatic gluconeogenesis?

The molecular mechanism of SLC25A47's influence on hepatic gluconeogenesis involves its role in mitochondrial pyruvate flux and malate export. In SLC25A47-deficient livers, there is an accumulation of mitochondrial malate, suggesting that SLC25A47 may function as a malate transporter . This accumulation disrupts the malate-aspartate shuttle, which is crucial for maintaining NAD+/NADH balance and supporting gluconeogenesis.

RNA-seq analysis of SLC25A47-deficient livers reveals compensatory upregulation of gluconeogenic genes, including Pkm, Eno3, Aldoa, Fbp1, Gpi1, and G6pc3 . Interestingly, there is a distinct regulation pattern between mitochondrial matrix-localized enzymes and cytosolic enzymes. Mitochondrial TCA cycle enzymes (Cs, Idh2, Suclg2) and the mitochondrial form of PEPCK (Pck2) are significantly upregulated in SLC25A47-deficient livers, while the cytosolic form of PEPCK (Pck1) remains unchanged . This suggests a compensatory metabolic adaptation to overcome disrupted mitochondrial substrate transport.

How do acute versus chronic SLC25A47 depletion differ in their metabolic effects?

Acute and chronic SLC25A47 depletion show both similarities and important differences in their metabolic effects:

Acute Depletion (via AAV-Cre administration):

  • Reduced body-weight gain

  • Increased serum FGF21 levels and hepatic FGF21 mRNA expression

  • Reduced fasting serum glucose and insulin levels

  • Improved systemic pyruvate tolerance and insulin tolerance

  • No noticeable liver fibrosis or damage

  • No alterations in liver fibrosis marker genes

  • No significant difference in mitochondrial Complex I and II activities

Chronic Depletion (genetic knockout):

  • Minimal impact on body weight and food intake (on both low-fat and high-fat diets)

  • No significant differences in liver and gonadal fat pad weights

  • Improved glucose tolerance

  • No significant differences in hepatic triglyceride and glycogen levels

  • No significant differences in plasma glucose, cholesterol, triglycerides, glycerol, and NEFA

  • No significant differences in the expression of PPARα target genes or fibrosis markers

What contradictions exist in the literature regarding SLC25A47's function as a mitochondrial uncoupling protein?

There are significant contradictions in the literature regarding SLC25A47's potential role as a mitochondrial uncoupling protein:

  • High-resolution respirometry experiments in Hepa 1-6 cells transiently transfected with Slc25a47 showed no significant difference compared to control cells in any respiratory parameters, either under normal conditions or after lipid loading .

  • Respirometry analysis on permeabilized livers of AAV-Slc25a47 and AAV-Gfp infected mice showed no significant differences in mitochondrial respiration parameters .

  • ATP content was not different between Hepa 1-6 cells stably expressing Slc25a47 or Gfp .

These results collectively suggest that, contrary to earlier hypotheses, SLC25A47 does not function primarily as a mitochondrial uncoupling protein. Instead, current evidence points to its role as a mitochondrial transporter involved in malate export and pyruvate metabolism .

How does SLC25A47 deficiency affect the transcriptome and metabolome?

SLC25A47 deficiency has modest but specific effects on both the transcriptome and metabolome:

Transcriptomic Effects:

  • RNA sequencing on livers of fasted wild-type and Slc25a47−/− mice revealed relatively small effects on the hepatic transcriptome

  • Only two genes met the significance threshold (FDR < 0.05): Slc25a47 itself and Nnt (Nicotinamide Nucleotide Transhydrogenase)

  • Pathway analysis of downregulated genes (P < 0.005) identified pathways related to amino acid and lipid metabolism

  • Unlike previous studies, no changes were observed in the expression of mitochondrial stress response genes (Fgf21, Lonp, Hspa9, and Yme1l1)

Metabolomic Effects:

  • The largest effects of SLC25A47 deficiency were observed in plasma metabolites

  • Principal component analysis (PCA) showed no clear separation between wild-type and Slc25a47−/− mice across three different matrices

  • Plasma levels of several metabolites were elevated in Slc25a47−/− mice, including homocitrulline, α-ketoglutaric acid, malic acid, ureidosuccinic acid, maleic acid, fumaric acid, and N-acetylaspartic acid

  • These metabolites are either TCA cycle intermediates and/or involved in amino acid metabolism

  • Pathway analysis confirmed effects on amino acid metabolism, the TCA cycle, and the oxidation of branched-chain amino acids

What are the optimal methods for studying SLC25A47 function in vitro?

For studying SLC25A47 function in vitro, several complementary approaches have proven effective:

Cell Models:

  • Hepa 1-6 cells, which do not endogenously express Slc25a47, provide an excellent system for gain-of-function studies through transfection

  • HepG2 cells (human hepatoma) and primary human hepatocytes can be used to study the regulation of SLC25A47 expression, particularly in response to PPARα activation

Expression Systems:

  • Transient transfection for short-term studies of SLC25A47 function

  • Stable transfection for long-term studies requiring consistent expression levels

  • Viral vectors (such as adenovirus) for efficient gene delivery to hepatocytes

Functional Assays:

  • Mitochondrial Localization Studies:

    • Fluorescent tagging of SLC25A47 combined with mitochondrial markers (e.g., Mitotracker Red FM) for co-localization studies using confocal microscopy

  • Respirometry Analysis:

    • High-resolution respirometry on an Oroboros Oxygraph 2k to measure oxygen consumption rates and assess various respiratory parameters

    • Coupling Control Protocol to evaluate ROUTINE, LEAK, ETS, and ROX respiration

  • Metabolic Flux Analysis:

    • Isotope tracing experiments using 13C-labeled substrates to track metabolic pathways

    • Measurement of gluconeogenic flux using labeled lactate or pyruvate

  • ATP Content Measurement:

    • Luciferase-based assays to quantify cellular ATP content

How can researchers effectively manipulate SLC25A47 expression in animal models?

Several effective strategies for manipulating SLC25A47 expression in animal models have been demonstrated:

Genetic Knockout Models:

  • Conventional knockout mice (Slc25a47−/−) for studying the complete loss of gene function

  • Conditional knockout using Cre-loxP system (e.g., Slc25a47 Alb-Cre) for tissue-specific deletion in the liver

Acute Depletion Approaches:

  • AAV-Cre administration to Slc25a47fl/fl mice for inducible, acute depletion of SLC25A47 in adult animals

  • This approach allows the study of SLC25A47 function without developmental compensations that may occur in germline knockouts

Overexpression Systems:

  • AAV-Slc25a47 for overexpression studies to assess gain-of-function effects

Experimental Considerations:

  • Validation of knockdown/knockout efficiency:

    • Quantitative PCR for mRNA levels

    • Western blotting for protein levels

    • Re-genotyping to confirm genetic status

  • Background strain selection:

    • Be aware of potential genetic artifacts such as the Nnt mutation in C57BL/6J mice, which may confound results

  • Dietary interventions:

    • Studies under both normal chow and high-fat diet conditions to assess metabolic phenotypes

    • Fasting protocols to accentuate gluconeogenic phenotypes

What techniques are most appropriate for assessing the impact of SLC25A47 on mitochondrial function?

To comprehensively assess the impact of SLC25A47 on mitochondrial function, researchers should employ multiple complementary techniques:

Respirometry Analyses:

  • High-resolution respirometry on isolated mitochondria, permeabilized tissues, or intact cells

  • Measurement of key parameters including basal respiration, ATP-linked respiration, proton leak, maximal respiration, and spare respiratory capacity

  • Analysis of substrate-specific respiration using various substrates (pyruvate, glutamate, malate, succinate, etc.)

Mitochondrial Complex Activity Assays:

  • Spectrophotometric assays to measure the activities of individual respiratory chain complexes (I-V)

  • Blue native PAGE to assess the assembly of respiratory supercomplexes

Mitochondrial Membrane Potential:

  • Fluorescent probes (e.g., TMRM, JC-1) to assess mitochondrial membrane potential

  • Time-lapse imaging to monitor dynamic changes in membrane potential

Mitochondrial Metabolomics:

  • Targeted metabolomics of isolated mitochondria to measure TCA cycle intermediates and related metabolites

  • Comparison of metabolite profiles between wild-type and SLC25A47-deficient models

Transport Assays:

  • Reconstitution of SLC25A47 in liposomes for direct measurement of transport activities

  • Assessment of substrate specificity using various metabolites (malate, pyruvate, etc.)

Mitochondrial Stress Response:

  • Analysis of mitochondrial stress response genes (e.g., Fgf21, Lonp, Hspa9, Yme1l1)

  • Assessment of mitochondrial morphology and dynamics

How should researchers interpret contradictory data on SLC25A47 function?

When faced with contradictory data on SLC25A47 function, researchers should consider several factors:

What are the key considerations when interpreting transcriptomic and metabolomic data in SLC25A47 studies?

When interpreting transcriptomic and metabolomic data in SLC25A47 studies, researchers should consider:

For Transcriptomic Data:

  • Pathway-level analysis rather than individual gene changes, especially when effects are subtle

  • Context-specific regulation - the impact on mitochondrial matrix-localized enzymes may differ from cytosolic enzymes

  • Compensatory changes in expression of related transporters or metabolic enzymes

  • Integration with known regulatory networks such as the PPARα pathway

  • Validation of key findings using qPCR or protein expression analysis

For Metabolomic Data:

  • Compartmentalization - distinguish between mitochondrial, cytosolic, and plasma metabolite changes

  • Flux vs. steady-state levels - changes in metabolite concentrations may reflect altered flux through pathways rather than absolute changes in metabolism

  • Indirect effects - alterations in one metabolic pathway may lead to cascading changes in other pathways

  • Sample preparation effects - particularly important for mitochondrial metabolites

  • Biological relevance of statistically significant changes - small but significant changes may not always be biologically meaningful

Integration Strategies:

  • Multi-omics integration - combine transcriptomic and metabolomic data to identify concordant patterns

  • Validation with functional assays - confirm the biological significance of omics findings with targeted functional studies

  • Consideration of temporal dynamics - metabolic changes may precede transcriptional responses or vice versa

How can researchers differentiate between direct and indirect effects of SLC25A47 manipulation?

Differentiating between direct and indirect effects of SLC25A47 manipulation requires careful experimental design and analysis:

Approaches to Identify Direct Effects:

  • Acute Interventions:

    • Use acute depletion or inhibition (e.g., AAV-Cre in Slc25a47fl/fl mice) to minimize compensatory changes

    • Analyze early timepoints after intervention to capture primary effects before secondary adaptations occur

  • Reconstitution Experiments:

    • Express wild-type SLC25A47 in knockout models to confirm reversibility of phenotypes

    • Use structure-function studies with mutated versions of SLC25A47 to identify critical domains

  • Direct Biochemical Assays:

    • Reconstitute purified SLC25A47 in liposomes to directly measure transport activities

    • Use in vitro assays with isolated mitochondria to assess immediate functional consequences

  • Tissue-Specific Manipulations:

    • Use liver-specific manipulations (e.g., Alb-Cre) to distinguish hepatic from systemic effects

Strategies to Identify Indirect or Compensatory Effects:

  • Time-Course Analyses:

    • Monitor changes over time to distinguish primary from secondary effects

    • Compare acute vs. chronic interventions to identify adaptive responses

  • Pathway Inhibition:

    • Use inhibitors of key compensatory pathways to determine their contribution to the observed phenotype

    • For example, inhibit upregulated gluconeogenic enzymes to assess their role in adapting to SLC25A47 deficiency

  • Multi-Tissue Analyses:

    • Examine effects in both liver and peripheral tissues to identify systemic adaptations

    • Measure circulating factors (e.g., FGF21) that may mediate inter-organ communication

  • Combined Interventions:

    • Perform double knockouts or combined inhibition of SLC25A47 and potential compensatory pathways

    • This approach can reveal masked phenotypes or synergistic effects

What are the potential therapeutic applications of targeting SLC25A47 for metabolic diseases?

SLC25A47 presents several promising therapeutic applications for metabolic diseases:

For Type 2 Diabetes and Hyperglycemia:

  • Targeting SLC25A47 could help restrict excess hepatic gluconeogenesis, which is commonly observed in human hyperglycemia and type 2 diabetes

  • Genome-wide association studies (GWAS) have found significant associations between SLC25A47 SNPs and glycemic homeostasis in humans, with several SNPs associated with lower glucose and HbA1c levels adjusted for BMI

  • The liver-specific expression pattern of SLC25A47 provides a unique opportunity for targeted intervention without affecting other tissues

Advantages of SLC25A47 as a Therapeutic Target:

  • Tissue Specificity:

    • SLC25A47 is exceptionally unique among the 53 members of the mitochondrial SLC25A carriers due to its selective expression in the liver

    • This specificity allows for liver-targeted interventions similar to successful examples of liver-targeting mitochondrial uncouplers that have protected mice against diabetes, hepatic steatosis, and cardiovascular complications

  • Partial Inhibition Strategy:

    • Acute depletion of SLC25A47 by approximately 50% appears sufficient to restrict gluconeogenesis and enhance insulin tolerance without causing detrimental side effects

    • This suggests that partial inhibition using small-molecule inhibitors or antisense oligonucleotides could be effective while avoiding side effects associated with complete deletion

  • Metabolic Benefits:

    • Improved glucose tolerance and insulin sensitivity

    • Reduced fasting glucose levels

    • Increased FGF21 levels, which may have additional metabolic benefits

Potential Therapeutic Approaches:

  • Small-molecule inhibitors that specifically target SLC25A47's transport function

  • Antisense oligonucleotides for partial knockdown of SLC25A47 expression

  • Liver-targeted delivery systems to enhance specificity and reduce off-target effects

What are the critical knowledge gaps that need to be addressed in future SLC25A47 research?

Several critical knowledge gaps need to be addressed to advance SLC25A47 research:

  • Precise Transport Function:

    • Definitive identification of the specific metabolites transported by SLC25A47

    • Kinetic parameters and substrate specificity of SLC25A47 transport activity

    • Structural determinants of substrate binding and transport mechanism

  • Regulatory Mechanisms:

    • Post-translational modifications that regulate SLC25A47 activity

    • Additional transcriptional regulators beyond PPARα

    • Mechanisms of acute regulation in response to nutritional status or hormonal signals

  • Human Relevance:

    • Functional significance of SNPs in human SLC25A47 associated with glycemic traits

    • Correlation between hepatic SLC25A47 expression/activity and metabolic disease states in humans

    • Potential compensatory mechanisms in human patients with altered SLC25A47 function

  • Long-Term Consequences:

    • Safety and efficacy of long-term partial inhibition of SLC25A47

    • Potential adaptation mechanisms that might limit therapeutic efficacy over time

    • Interactions with existing diabetes medications

  • Broader Metabolic Impacts:

    • Effects on lipid metabolism and hepatic steatosis

    • Potential involvement in other liver-specific metabolic pathways

    • Role in inter-organ metabolic communication beyond FGF21 induction

  • Therapeutic Targeting:

    • Development of specific inhibitors or modulators of SLC25A47

    • Optimal degree of inhibition for therapeutic benefit without side effects

    • Delivery strategies for liver-specific targeting

How might SLC25A47 research impact our understanding of mitochondrial metabolism beyond gluconeogenesis?

SLC25A47 research has potential to significantly expand our understanding of mitochondrial metabolism beyond gluconeogenesis:

Mitochondrial Transport Systems:

  • SLC25A47 provides a model for understanding tissue-specific adaptations in mitochondrial carrier systems

  • Insights into how specialized mitochondrial transporters contribute to tissue-specific metabolic programs

  • New perspectives on the coordination between mitochondrial and cytosolic metabolic pathways

Metabolic Flexibility:

  • Understanding how mitochondrial transport proteins like SLC25A47 contribute to metabolic flexibility during fasting-feeding transitions

  • Insights into liver-specific adaptations to different nutritional states

  • Mechanisms of cross-talk between gluconeogenesis and other metabolic pathways

Mitochondrial-Nuclear Communication:

  • SLC25A47 research reveals connections between mitochondrial metabolite transport and nuclear gene expression

  • The compensatory upregulation of mitochondrial and gluconeogenic genes in SLC25A47-deficient livers demonstrates retrograde signaling from mitochondria to nucleus

  • This may provide insights into broader aspects of mitochondrial-nuclear communication

Integration with Other Metabolic Pathways:

  • Links between TCA cycle regulation, amino acid metabolism, and gluconeogenesis

  • Role of mitochondrial transporters in coordinating various metabolic pathways

  • Potential connections to fatty acid metabolism through the PPARα regulatory network

Therapeutic Approaches for Mitochondrial Disorders:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.