Recombinant Human Solute carrier family 25 member 48 (SLC25A48)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

SLC25A48 is a mitochondrial inner-membrane protein critical for choline transport and downstream metabolic processes. Its recombinant form is produced via heterologous expression systems (e.g., E. coli), enabling functional and structural studies. Key features include:

  • Gene ID: 153328 (human) .

  • UniProt ID: Q6ZT89 .

  • Function: Mediates mitochondrial choline uptake, synthesis of betaine, and purine nucleotide production .

Production and Characteristics

Recombinant SLC25A48 is produced via bacterial expression systems, with optimized protocols for yield and stability.

ParameterSpecification
Expression HostE. coli
PurificationHis-tag affinity chromatography
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water (0.1–1.0 mg/mL); glycerol (5–50%) recommended

Key Considerations:

  • Stability: Repeated freeze-thaw cycles degrade activity; store at -20°C/-80°C .

  • Applications: Used in biochemical assays, structural studies, and functional reconstitution experiments .

Functional Roles and Research Findings

SLC25A48 is central to mitochondrial choline metabolism, with implications for cellular energy production and nucleotide synthesis.

Mitochondrial Choline Transport

  • Mechanism: Facilitates choline import into the mitochondrial matrix, enabling conversion to betaine aldehyde and betaine .

  • Consequences of Deficiency:

    • Elevated plasma/urine choline levels due to impaired transport .

    • Reduced mitochondrial respiration (Complex I/II activity) .

Role in One-Carbon Metabolism

  • Betaine Synthesis: Choline-derived betaine serves as a methyl donor for purine nucleotide synthesis .

  • Purine Nucleotide Pools: SLC25A48 knockout cells exhibit reduced adenine/guanine levels, impairing G1-to-S phase transition .

Cancer Metabolism

  • Cancer Cell Dependency: Knockout of SLC25A48 induces apoptosis in ovarian, lung, and pancreatic cancer cells .

  • Oxidative Stress: Loss of SLC25A48 increases mitochondrial ROS production, exacerbating DNA damage .

Human Genetic Studies

  • GWAS Associations: Variants in SLC25A48 (e.g., rs6596270) correlate with elevated choline levels in men .

  • Mutational Impact: Loss-of-function mutations impair mitochondrial choline import, linking to metabolic disorders .

Therapeutic Potential

  • Cancer Therapy: Targeting SLC25A48 could disrupt purine synthesis in choline-dependent cancers .

  • Metabolic Disorders: Modulating SLC25A48 activity may address choline deficiency or excess-related pathologies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
SLC25A48; Solute carrier family 25 member 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A48
Target Protein Sequence
MGSFQLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFK GMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGL GGPVDLIKIRLQMQTQPFRDANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRG ASAMLLRDVPGYCLYFIPYVFLSEWITPEACTGPSPCAVWLAGGMAGAISWGTATPMDVV KSRLQADGVYLNKYKGVLDCISQSYQKEGLKVFFRGITVNAVRGFPMSAAMFLGYELSLQ AIRGDHAVTSP
Uniprot No.

Target Background

Database Links

HGNC: 30451

OMIM: 616150

KEGG: hsa:153328

STRING: 9606.ENSP00000413049

UniGene: Hs.412418

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A48 and what is its cellular localization?

SLC25A48 is a previously uncharacterized mitochondrial carrier protein that belongs to the solute carrier family 25. High-resolution microscopy studies using FLAG-tagged SLC25A48 have definitively established its localization to the inner mitochondrial membrane (IMM). The protein does not colocalize with outer mitochondrial membrane (OMM) markers like TOM20, and crucially, remains intact during proteinase K treatment that degrades OMM proteins while sparing IMM components like ATP5A . This localization is consistent with its function as a mitochondrial transporter. The protein contains six transmembrane domains that form its characteristic carrier structure, with exon 4 encoding two of these critical domains .

What are the main physiological functions of SLC25A48?

SLC25A48 primarily functions as a choline transporter in the mitochondrial inner membrane, facilitating choline uptake into the mitochondrial matrix. This transport function is essential for several critical processes:

  • Mitochondrial choline catabolism leading to betaine synthesis

  • One-carbon metabolism and purine nucleotide synthesis

  • Maintenance of mitochondrial membrane integrity

  • Regulation of mitochondrial reactive oxygen species (ROS) production

  • Support of brown adipose tissue (BAT) thermogenesis

  • Cell proliferation and survival

Experimental studies have demonstrated that loss of SLC25A48 results in impaired mitochondrial respiration, increased ROS production, and altered mitochondrial membrane lipid composition, ultimately affecting cellular viability and thermogenic capacity .

How is SLC25A48 expressed across different tissues?

SLC25A48 exhibits a tissue-specific expression pattern that correlates with its physiological functions. The protein is highly expressed in brown adipose tissue (BAT), liver, and kidney . Interestingly, despite the high mitochondrial content in cardiac and skeletal muscle tissues, SLC25A48 expression is nearly undetectable in heart and soleus muscle . This tissue distribution pattern suggests specialized roles for SLC25A48 in tissues with high energetic demands or specific metabolic functions requiring mitochondrial choline metabolism.

During brown adipocyte differentiation, SLC25A48 expression increases, indicating its importance in mature brown adipocyte function and thermogenesis . The distinctive expression profile of SLC25A48 makes it a potential target for tissue-specific metabolic interventions.

What genetic approaches can be used to study SLC25A48 function?

Several genetic approaches have proven effective for investigating SLC25A48 function:

  • Germline knockout models: Mice with homozygous deletion of SLC25A48 (lacking exon 4 which encodes two transmembrane domains) develop normally but show impaired cold tolerance and thermogenesis .

  • Cell-specific knockout: CRISPR-Cas9 genome editing can be used to generate SLC25A48-deficient cell lines for mechanistic studies .

  • SNP knockin models: CRISPR-Cas9 with homology-directed repair (HDR) has been used to introduce specific polymorphisms like rs200164783 (A>G), which causes exon 5 skipping and alters SLC25A48 function .

  • Rescue experiments: Reintroduction of wild-type SLC25A48 into knockout cells can confirm phenotype specificity and rule out off-target effects .

  • Codon-optimized expression: For recombinant studies, codon-optimized SLC25A48 cDNA (available from Addgene #131995) with epitope tags facilitates protein detection and functional analysis .

These approaches provide complementary insights into SLC25A48 function at both organismal and cellular levels.

How can I assess mitochondrial choline transport mediated by SLC25A48?

Assessment of SLC25A48-mediated choline transport requires specialized techniques that directly measure mitochondrial uptake. Based on published methodologies, the following protocol is recommended:

  • Radiolabeled choline transport assay: Isolate mitochondria from control and SLC25A48-manipulated cells or tissues. Incubate the isolated mitochondria with radiolabeled choline (e.g., 5 nM [3H]choline) and measure mitochondrial radioactivity at various time points (0-60 minutes). Calculate the rate of choline uptake normalized to protein content .

  • Stable isotope tracing: Incubate cells with heavy-labeled choline (e.g., choline-d9, 20 μM) and monitor the appearance of labeled metabolites in mitochondrial fractions using liquid chromatography-mass spectrometry (LC-MS). Focus particularly on the formation of betaine (M+9) as a marker of mitochondrial choline metabolism .

  • Mitochondrial fractionation quality control: Ensure high-quality mitochondrial preparations by validating the purity with western blotting for mitochondrial markers (ATP5A) and excluding contamination with other cellular compartments .

For comprehensive analysis, these measurements should be performed in multiple conditions:

  • With and without competing unlabeled substrates

  • Across a range of substrate concentrations to determine kinetic parameters

  • With inhibitors of related transporters to establish specificity

  • In models with wild-type, knockout, and rescued SLC25A48 expression

What are the metabolic consequences of SLC25A48 dysfunction?

SLC25A48 dysfunction leads to a cascade of metabolic alterations that affect multiple cellular processes:

Metabolic ParameterEffect of SLC25A48 LossExperimental MethodSignificance
Mitochondrial Choline ImportDecreased[3H]choline uptakeDirectly demonstrates transport function
Betaine ProductionReducedLC-MS (M+9 labeling)Indicates impaired choline oxidation
Mitochondrial H₂O₂ ProductionIncreasedFluorometric H₂O₂ assayMarker of electron leak and oxidative stress
Lipid PeroxidationElevatedSerum malondialdehyde (MDA) measurementConfirms systemic oxidative stress
Mitochondrial Membrane LipidsAlteredLipidomicsShows changes in hexosylceramides, ceramides, phosphatidylcholine, and phosphatidylethanolamine species
Purine Nucleotide SynthesisImpairedMetabolomicsAffects ATP synthesis and nucleic acid production
Mitochondrial FAD LevelsReducedLC-MSImpacts respiratory chain function
Mitochondrial RespirationDecreasedOxygen consumption rateCompromises energy production

These metabolic consequences explain the physiological phenotypes observed in SLC25A48-deficient models, including impaired thermogenesis, increased oxidative stress, and reduced cell proliferation. The connecting link between these alterations appears to be the role of mitochondrial choline metabolism in one-carbon metabolism, electron transport chain function, and mitochondrial membrane integrity .

How do single nucleotide polymorphisms (SNPs) in SLC25A48 affect its function?

Genome-wide association studies (GWAS) have identified SNPs in SLC25A48 with significant functional consequences. The most notable is rs200164783, an A>G substitution that alters a highly conserved splice acceptor site at the 3' end of intron 4 .

This polymorphism has the following functional consequences:

  • Altered mRNA splicing: The A>G substitution causes complete skipping of exon 5, as confirmed by Sanger sequencing and qPCR analysis of cDNA from cells with the knocked-in SNP .

  • Protein structure disruption: Exon 5 encodes two transmembrane domains of the SLC25A48 protein, suggesting the resulting protein would have impaired transport function .

  • Metabolic impact: Individuals carrying this SNP show significantly altered plasma choline levels (p = 2.3e-33), making it the most significant SNP for choline across the genome in a study of 6,136 Finnish men .

  • Cellular phenotypes: Cells engineered to carry this SNP exhibit:

    • Increased mitochondrial ROS production

    • Impaired cell cycle progression (G1-to-S phase transition)

    • Altered choline metabolism

  • Partial rescue by betaine: While betaine supplementation (10 mM for 6 hours) can normalize mitochondrial ROS levels in SNP-carrying cells, it fails to fully restore cell growth, suggesting additional SLC25A48 functions beyond betaine synthesis .

This example demonstrates how SNPs can provide valuable insights into protein function and potentially explain metabolic variations in human populations.

What techniques can be used to study SLC25A48's role in thermogenesis?

Investigating SLC25A48's role in thermogenesis requires a combination of in vivo and ex vivo approaches:

  • Cold tolerance testing: Subject control and SLC25A48-knockout mice to cold challenge (e.g., 4°C) and monitor core body temperature over time. SLC25A48-KO mice show significantly impaired cold tolerance .

  • Brown adipose tissue (BAT) respiration: Isolate BAT mitochondria and measure oxygen consumption using substrates that feed into complex I and II. Compare respiration rates with and without guanosine diphosphate (GDP), which inhibits uncoupling protein 1 (UCP1), to assess UCP1-dependent thermogenesis .

  • Electron microscopy: Analyze mitochondrial ultrastructure in BAT, focusing on cristae density and mitochondrial morphology. SLC25A48-KO BAT shows enlarged mitochondria with less dense cristae .

  • Mitochondrial complex activity assays: Directly measure the activities of respiratory chain complexes I and II, which are impaired in SLC25A48-KO mice .

  • ROS production measurement: Assess hydrogen peroxide (H₂O₂) production in isolated BAT mitochondria using fluorometric assays, as elevated ROS may explain thermogenic defects .

  • Lipidomics of BAT mitochondria: Analyze mitochondrial membrane lipid composition, which is altered in SLC25A48-KO mice and may affect membrane integrity and electron transport .

  • Proteomics: Perform quantitative tandem mass tag proteomics to identify changes in the mitochondrial proteome of BAT in response to conditions like high-fat diet, which upregulates SLC25A48 expression .

These complementary approaches provide a comprehensive assessment of how SLC25A48 contributes to BAT thermogenesis through its effects on mitochondrial function, ROS production, and membrane integrity.

How does SLC25A48 contribute to cancer cell metabolism and survival?

SLC25A48 plays a critical role in cancer cell metabolism and survival through several interconnected pathways:

  • Cell cycle regulation: SLC25A48 depletion impairs G1-to-S phase transition in multiple cancer cell lines, including ovarian cancer (SKOV3), pancreatic adenocarcinoma (PA-TU-8988T), non-small-cell lung cancer (A549 and H1299), and osteosarcoma (U2OS) cells .

  • Cell viability: Genetic loss of SLC25A48 using CRISPR-Cas9 results in substantial cell death within 24 hours across different cancer types (over 50% in ovarian and lung cancer cells, 20% in pancreatic cancer cells) .

  • Purine nucleotide synthesis: SLC25A48 supports de novo purine nucleotide synthesis, which is critical for cancer cell proliferation. This connection is particularly relevant given the high demand for nucleotides in rapidly dividing cancer cells .

  • Oxidative stress management: Cancer cells lacking SLC25A48 show increased mitochondrial ROS production, which may contribute to their reduced viability .

For researchers studying SLC25A48 in cancer contexts, the following experimental approaches are recommended:

  • CRISPR-Cas9-mediated knockout to assess the dependency of specific cancer types on SLC25A48

  • Cell cycle analysis by flow cytometry to determine the specific checkpoint affected

  • Metabolomics to profile changes in purine nucleotides and one-carbon metabolism

  • Combination studies with agents targeting related metabolic pathways

  • Rescue experiments with betaine supplementation to determine the extent to which choline metabolism mediates the observed effects

These approaches can help determine whether SLC25A48 represents a potential therapeutic target in specific cancer contexts and elucidate the metabolic vulnerabilities created by its inhibition.

What phylogenetic approaches can reveal functional connections of SLC25A48?

Phylogenetic analysis provides valuable insights into the functional connections of previously uncharacterized proteins like SLC25A48. The principle behind this approach is that proteins functioning in the same pathways often show similar patterns of sequence conservation across phylogenetic clades .

To implement this methodology:

  • Co-evolution analysis: Compare sequence conservation patterns of SLC25A48 across diverse eukaryotic organisms with known proteins to identify those with similar evolutionary profiles .

  • Cross-species validation: Perform the analysis in multiple species (e.g., humans and mice) to strengthen the reliability of predicted functional connections .

Applied to SLC25A48, this approach revealed that:

  • Adenosylhomocysteinase (AHCY) was the top co-evolved gene in humans and second in mice

  • Superoxide dismutase 2 (SOD2) was the top co-evolved gene in mice and second in humans

These findings provided critical insights into SLC25A48's functional connections:

  • AHCY involvement suggested a link to one-carbon metabolism and the methionine cycle

  • SOD2 association indicated a role in mitochondrial ROS management

Gene ontology analysis of the top 25 co-evolved genes further confirmed enrichment of the one-carbon cycle pathway . This phylogenetic approach effectively directed subsequent experimental investigations toward choline metabolism and ROS regulation, validating its utility in functional prediction.

How can stable isotope tracing be optimized to study SLC25A48-dependent metabolic pathways?

Stable isotope tracing is a powerful approach for elucidating SLC25A48-dependent metabolic pathways, particularly in choline metabolism. To optimize these studies:

  • Selection of labeled substrates:

    • Choline-d9 (20 μM) for tracking choline metabolism through betaine synthesis

    • 13C4, 15N2-riboflavin (M+6) for analyzing FAD synthesis and mitochondrial import

  • Temporal resolution:

    • Include early time points (5, 15, 30 minutes) to capture initial transport kinetics

    • Extend to longer periods (hours) to observe downstream metabolic effects

  • Subcellular fractionation:

    • Compare whole-cell and mitochondrial fractions to distinguish transport from metabolism

    • Validate fractionation purity with appropriate markers

  • Mass spectrometry analysis:

    • Monitor multiple isotopologues (M+0, M+9 for choline-d9)

    • Track labeled and unlabeled metabolites to assess both pool sizes and flux rates

  • Experimental controls:

    • Compare SLC25A48-KO, wild-type, and rescue cell lines under identical conditions

    • Include competitive inhibitors when available

  • Data interpretation:

    • Distinguish decreased mitochondrial metabolite levels due to impaired transport versus altered synthesis

    • Consider indirect effects on related metabolic pathways

This optimized approach has revealed that SLC25A48 specifically facilitates mitochondrial choline import for betaine synthesis, while not being involved in FAD import despite affecting FAD levels indirectly through purine nucleotide synthesis .

What are the critical considerations for generating and validating recombinant SLC25A48 for functional studies?

Generating functional recombinant SLC25A48 for research studies requires attention to several critical factors:

  • Codon optimization: Using codon-optimized sequences (like that available from Addgene #131995) improves expression efficiency in heterologous systems .

  • Epitope tagging: Adding a C-terminal FLAG-tag facilitates protein detection while minimizing interference with function. The tag placement should avoid disrupting transmembrane domains or functional sites .

  • Expression vector selection: Use vectors appropriate for the experimental system. For stable cell lines, retroviral vectors like pMSCV with selectable markers (e.g., blasticidin) enable long-term expression .

  • Localization verification: Confirm proper mitochondrial inner membrane localization using:

    • Immunofluorescence microscopy with mitochondrial markers (TOM20)

    • Proteinase K protection assays that distinguish outer from inner membrane proteins

    • Subcellular fractionation followed by western blotting

  • Functional validation: Verify that the recombinant protein restores:

    • Mitochondrial choline transport in SLC25A48-KO cells

    • Normal mitochondrial H2O2 production

    • Cell proliferation and viability

  • Expression level considerations: Titrate expression levels to avoid artifacts from overexpression while ensuring sufficient protein for detection and function .

Following these guidelines ensures that experiments using recombinant SLC25A48 yield physiologically relevant results that accurately reflect the protein's native function.

What approaches can detect and quantify mitochondrial reactive oxygen species related to SLC25A48 function?

Accurate detection and quantification of mitochondrial reactive oxygen species (ROS) is essential for understanding SLC25A48 function. Multiple complementary approaches are recommended:

  • Isolated mitochondria H2O2 production assay:

    • Substrate-specific measurements using complex I and II substrates

    • Inhibition of thioredoxin reductase with auranofin to measure maximal H2O2 production (JH2O2)

    • Normalization to mitochondrial protein content

  • MitoSOX fluorescence:

    • Live-cell imaging or flow cytometry to detect mitochondrial superoxide

    • Particularly useful for comparing control and SLC25A48-deficient cells

    • Can be used to assess the effects of interventions like betaine supplementation

  • Lipid peroxidation markers:

    • Serum malondialdehyde (MDA) measurement as a systemic marker

    • Mitochondrial lipidomics to detect oxidized lipid species, especially hexosylceramides with oxygen adducts

  • Mitochondrial antioxidant systems:

    • Assessment of SOD2 activity, which co-evolves with SLC25A48

    • Glutathione levels and redox state in mitochondrial fractions

  • Functional consequences of ROS:

    • Mitochondrial membrane potential measurements

    • Assessment of respiratory complex activities, which can be impaired by ROS

    • Electron microscopy to evaluate structural changes in mitochondrial cristae

These methods collectively provide a comprehensive picture of how SLC25A48 dysfunction leads to increased mitochondrial ROS production, which mediates many of the observed phenotypes in SLC25A48-deficient models.

How might SLC25A48 research inform metabolic disease treatments?

Research on SLC25A48 has significant implications for metabolic disease treatments through several potential mechanisms:

  • Brown adipose tissue (BAT) thermogenesis: SLC25A48 is upregulated in BAT in response to high-fat diet and is required for thermogenesis . This suggests that enhancing SLC25A48 function might increase energy expenditure to combat obesity.

  • Mitochondrial ROS management: SLC25A48 deficiency increases mitochondrial ROS production . Targeting this pathway could address oxidative stress in metabolic disorders like diabetes and non-alcoholic fatty liver disease.

  • One-carbon metabolism: SLC25A48's role in choline transport affects one-carbon metabolism and purine nucleotide synthesis . This pathway is critical for methylation reactions and nucleic acid synthesis, both relevant to metabolic health.

  • Personalized nutrition: The association between SLC25A48 SNPs and plasma choline levels suggests that individuals with certain genetic variants might benefit from personalized choline supplementation strategies.

Future research should investigate:

  • Tissue-specific SLC25A48 modulators that could enhance BAT activation

  • The therapeutic potential of betaine supplementation in individuals with SLC25A48 polymorphisms

  • The interaction between SLC25A48 function and other metabolic pathways affected in diseases like insulin resistance and mitochondrial disorders

What technical challenges remain in studying mitochondrial choline transport?

Despite significant advances, several technical challenges persist in studying mitochondrial choline transport mediated by SLC25A48:

  • Transport kinetics characterization:

    • Determining precise Km and Vmax values for SLC25A48-mediated choline transport

    • Identifying potential competitive inhibitors for research applications

    • Understanding the energetics and direction of transport (symport/antiport mechanisms)

  • Structural biology challenges:

    • No crystal or cryo-EM structure of SLC25A48 is available

    • Difficulty in expressing and purifying sufficient quantities of functional protein

    • Challenges in reconstituting the protein in lipid environments that mimic the IMM

  • In vivo transport visualization:

    • Limited tools for real-time imaging of choline transport in living cells

    • Need for fluorescent choline analogs that maintain transport properties

    • Difficulty in distinguishing transport from metabolism

  • Tissue heterogeneity:

    • Variations in SLC25A48 expression and function across tissues

    • Cell type-specific roles within heterogeneous tissues like BAT

    • Potential compensatory mechanisms in different physiological contexts

  • Regulatory mechanisms:

    • Limited understanding of how SLC25A48 activity is regulated post-translationally

    • Unknown effects of mitochondrial membrane potential on transport activity

    • Potential interactions with other mitochondrial proteins

Addressing these challenges will require interdisciplinary approaches combining structural biology, advanced imaging techniques, and physiological studies in diverse model systems.

How do SLC25A48 findings connect to broader mitochondrial biology concepts?

SLC25A48 research has revealed important connections to broader concepts in mitochondrial biology:

  • Compartmentalization of metabolism: The discovery of SLC25A48 as a mitochondrial choline transporter emphasizes how metabolic pathways are distributed across cellular compartments, requiring specific transporters to connect them. This reinforces the concept that mitochondria are not just energy producers but active metabolic hubs requiring extensive communication with the cytosol .

  • Mitochondrial membrane integrity: SLC25A48 deficiency alters mitochondrial membrane lipid composition, particularly affecting hexosylceramides, ceramides, and phospholipids . This highlights the importance of precise lipid composition for mitochondrial function and how transporters can indirectly influence membrane properties.

  • Redox homeostasis: The connection between SLC25A48 and mitochondrial ROS production demonstrates how metabolite transport can affect electron flow and redox balance. The co-evolution of SLC25A48 with SOD2 further emphasizes this relationship .

  • Metabolic flexibility: The upregulation of SLC25A48 in BAT during high-fat diet conditions suggests its role in metabolic adaptation to nutritional challenges . This exemplifies how mitochondrial transporters are dynamically regulated to meet changing metabolic demands.

  • One-carbon metabolism integration: SLC25A48's involvement in choline-derived one-carbon metabolism connects mitochondrial function to essential processes like nucleotide synthesis and methylation reactions . This illustrates how mitochondria participate in metabolism beyond bioenergetics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.