Recombinant Human Solute carrier family 26 member 10 (SLC26A10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
SLC26A10; Solute carrier family 26 member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-563
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC26A10
Target Protein Sequence
MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASVPPVFGLYTSF FPVLIYSLLGTGRHLSTGTFAILSLMTGSAVERLVPEPLVGNLSGIEKEQLDAQRVGVAA AVAFGSGALMLGMFVLQLGVLSTFLSEPVVKALTSGAALHVLLSQLPSLLGLSLPRQIGC FSLFKTLASLLTALPRSSPAELTISALSLALLVPVKELNVRFRDRLPTPIPGEVVLVLLA SVLCFTSSVDTRYQVQIVGLLPGGFPQPLLPNLAELPRILADSLPIALVSFAVSASLASI HADKYSYTIDSNQEFLAHGASNLISSLFSCFPNSATLATTNLLVDAGGKTQLAGLFSCTV VLSVLLWLGPFFYYLPKAVLACINISSMRQVFCQMQELPQLWHISRVDFLLQVPGLCILS YPTPLYFGTRGQFRCNLEWHLGLGEGEKETSKPDGPMVAVAEPVRVVVLDFSGVTFADAA GAREVVQVRERLASRCRDARIRLLLAQCNALVQGTLTRVGLLDRVTPDQLFVSVQDAAAY ALGSLLRGSSTRSGSQEALGCGK
Uniprot No.

Target Background

Function
Chloride/bicarbonate exchanger.
Database Links

HGNC: 14470

KEGG: hsa:65012

STRING: 9606.ENSP00000320217

UniGene: Hs.727726

Protein Families
SLC26A/SulP transporter (TC 2.A.53) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SLC26A10 and how does it relate to other SLC26 family members?

SLC26A10 is a member of the solute carrier family 26 (SLC26), a conserved multifunctional anion exchanger family consisting of 11 members (SLC26A1-SLC26A11). Like other family members, SLC26A10 likely contains transmembrane regions and a C-terminal STAS domain (sulfate transporter and anti-sigma factor antagonist) . Most SLC26 proteins function as anion exchangers, though SLC26A7 and SLC26A9 have been shown to act as anion channels alone . While the functions of other family members have been linked to various physiological processes and diseases (e.g., SLC26A2 with multiple epiphyseal dysplasia, SLC26A3 with congenital chloride diarrhea), the specific function of SLC26A10 in humans remains poorly characterized .

What is known about SLC26A10 protein structure?

Based on homology with other SLC26 family members, human SLC26A10 is predicted to have:

Structural FeatureDescription
Transmembrane domainsMultiple transmembrane regions (likely 11 based on homologous proteins)
STAS domainC-terminal sulfate transporter and anti-sigma factor antagonist domain
Functional motifsAnion transport domains

While the complete human SLC26A10 structure hasn't been fully resolved, studies on the orthologous protein in Nilaparvata lugens (NlSLC26A10) confirmed the presence of 11 transmembrane regions and a STAS domain . The STAS domain is particularly important as it mediates protein-protein interactions and plays essential roles in intracellular transport . Mutations in this domain in other SLC26 proteins result in impaired transport function .

What methods are effective for producing recombinant human SLC26A10 protein?

Recombinant human SLC26A10 can be produced using prokaryotic expression systems such as E. coli, as demonstrated by commercially available products . When designing expression constructs, consider:

  • Expression vector selection: Use vectors with strong promoters and appropriate purification tags (e.g., His6-tag).

  • Fusion tag optimization: N-terminal His6-ABP (Albumin Binding Protein) tags have been successfully used .

  • Codon optimization: Adapt the human sequence for E. coli expression to enhance protein yields.

  • Expression conditions: Optimize temperature, IPTG concentration, and expression duration to maximize soluble protein production.

For membrane proteins like SLC26A10, achieving proper folding can be challenging. Consider:

  • Using specialized E. coli strains designed for membrane protein expression

  • Employing detergent screening to identify optimal solubilization conditions

  • Exploring alternative expression systems (insect cells, mammalian cells) if E. coli yields unsatisfactory results

What approaches can researchers use to study SLC26A10 gene expression?

Based on methodologies described in SLC26 family research:

  • qPCR analysis: Design specific primers targeting unique regions of SLC26A10 to analyze its expression across different tissues and developmental stages. For example, in studies of the orthologous gene in N. lugens, qPCR revealed temporal expression patterns across developmental stages and tissue-specific expression .

  • RNA sequencing: For unbiased transcriptome-wide analysis of SLC26A10 expression and potential splice variants.

  • In situ hybridization: To visualize spatial expression patterns in tissue sections.

  • Promoter analysis: Clone the 5' flanking region containing the minimal promoter for functional studies, similar to approaches used for SLC26A1 .

When designing primers, researchers should be aware that variants in the human SLC26A10 gene may exist, similar to those found in SLC26A1 . Proper controls and validation of primers are essential to ensure specificity.

How can researchers functionally characterize SLC26A10?

Functional characterization of SLC26A10 can employ several complementary approaches:

  • RNA interference (RNAi): Design specific double-stranded RNA (dsRNA) targeting SLC26A10 to knockdown its expression. In N. lugens studies, RNAi effectively reduced NlSLC26A10 expression by 87-92% .

  • Anion transport assays: As SLC26A10 likely functions as an anion exchanger, researchers should design assays to measure transport of potential substrates:

    • Radiolabeled substrate uptake in cells expressing SLC26A10

    • Fluorescent substrate analogs for real-time transport measurements

    • Electrophysiological recordings using patch-clamp techniques

  • Heterologous expression systems: Express SLC26A10 in Xenopus oocytes, mammalian cell lines, or proteoliposomes for functional characterization.

  • Protein-protein interaction studies: Investigate interactions with other proteins, particularly through the STAS domain, using co-immunoprecipitation, yeast two-hybrid, or proximity labeling approaches.

How does SLC26A10 compare functionally with other characterized SLC26 family members?

While direct functional data on SLC26A10 is limited, comparative analysis with other SLC26 family members may provide insights:

SLC26 MemberKnown FunctionDisease AssociationPotential Relevance to SLC26A10
SLC26A1 (SAT1)Sulfate/oxalate exchangerCalcium oxalate stonesMay suggest similar anion exchange capabilities
SLC26A2Sulfate transporterMultiple epiphyseal dysplasiaStructural homology in transmembrane domains
SLC26A3Cl-/HCO3- exchangerCongenital chloride diarrheaPotential similar anion specificity
SLC26A4Cl-/HCO3-/I- transporterPendred syndromeInsights into potential substrate range
SLC26A8Anion exchangerMale infertilityPossible reproductive function connection

Researchers should consider the evolutionary conservation of specific structural features as potential indicators of functional similarity. For instance, the conservation of specific amino acid residues across species can suggest functional importance, as demonstrated by the conservation of M132 in human SLC26A1 across 15 species . Similar analysis of conserved residues in SLC26A10 may reveal functionally critical regions.

What mechanisms might explain SLC26A10's potential role in reproductive processes?

Based on studies of orthologous proteins in insects, several potential mechanisms may explain SLC26A10's role in reproduction:

  • Ion homeostasis regulation: SLC26A10 may maintain critical ion balances necessary for proper oocyte development. When NlSLC26A10 was silenced in N. lugens, ovarian development was hindered .

  • Substrate transport for development: Similar to other transporters like SLC15A4 in the Indian white shrimp, which transports amino acids to stimulate ovarian maturation, SLC26A10 may transport essential anions for reproductive processes .

  • Protein-protein interactions via STAS domain: The STAS domain could mediate interactions with proteins involved in reproductive pathways. When NlSLC26A10 was silenced, the STAS domain disruption potentially damaged protein-protein interactions on the oocyte surface .

  • Hormone regulation: In N. lugens, NlSLC26A10 silencing resulted in decreased juvenile hormone levels and reduced vitellogenin expression, suggesting a potential role in hormone-mediated reproductive processes .

These mechanisms should be considered hypotheses requiring experimental validation in mammalian systems.

How might genetic variants in SLC26A10 impact its function?

While specific variants in human SLC26A10 have not been well-documented in the provided search results, studies of related family members like SLC26A1 provide a framework for understanding potential impacts:

  • Missense mutations: Mutations causing amino acid substitutions may affect protein stability and function. For SLC26A1, variants like M132T were predicted to decrease protein stability, while Q556R was predicted to increase stability .

  • Promoter region variants: Variants in the 5'-untranslated region or promoter could affect gene expression levels. Such variants were identified in the SLC26A1 5'-flanking region in individuals with kidney stones .

  • Conservation-based analysis: Highly conserved amino acids across species are likely functionally important. For instance, M132 in SLC26A1 is conserved across 15 species and located within a transmembrane domain, suggesting functional importance .

For SLC26A10 research, similar approaches can be applied:

  • Screening for variants in patient cohorts with conditions potentially related to anion transport

  • Assessing the conservation of specific residues across species

  • Functional characterization of identified variants using transport assays

How can researchers overcome challenges in SLC26A10 expression and purification?

Membrane proteins like SLC26A10 present several challenges in recombinant expression and purification:

  • Protein insolubility:

    • Optimize detergent screening (start with mild detergents like DDM, LMNG)

    • Consider fusion partners known to enhance membrane protein solubility (e.g., MBP, SUMO)

    • Test different expression temperatures (16-30°C) to improve folding

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoters and induction conditions

    • Consider specialized expression hosts (C41/C43 E. coli strains for membrane proteins)

  • Protein instability:

    • Include stabilizing agents in purification buffers (glycerol, specific lipids)

    • Consider nanodiscs or amphipols for maintaining native-like lipid environment

    • Perform thermal stability assays to identify optimal buffer conditions

For antibody production, commercial recombinant SLC26A10 fragments with His6-ABP tags are available , which can serve as controls or antigens for antibody generation.

What considerations are important when designing functional assays for SLC26A10?

When establishing functional assays for a poorly characterized transporter like SLC26A10:

  • Substrate identification:

    • Based on the SLC26 family function, test common anions (sulfate, oxalate, chloride, bicarbonate)

    • Consider physiological context (tissue expression patterns) when selecting candidate substrates

    • Design assays with both direct (isotope flux) and indirect (pH changes, currents) readouts

  • Expression system selection:

    • Heterologous systems (Xenopus oocytes, HEK293 cells) should have low endogenous anion transport

    • Consider inducible expression systems to control expression timing and levels

    • Include proper controls (non-transfected cells, inactive mutants)

  • Transport kinetics:

    • Determine Km and Vmax values for identified substrates

    • Assess temperature dependence and pH sensitivity

    • Test potential inhibitors based on known blockers of other SLC26 transporters

Based on the approach used for NlSLC26A10 functional characterization, RNA interference combined with phenotypic assessment could provide insights into physiological roles .

How should researchers approach data interpretation for SLC26A10 studies?

Given the limited characterization of SLC26A10, researchers should be particularly careful when interpreting experimental results:

  • Comparative analysis framework:

    • Compare findings with better-characterized SLC26 family members

    • Consider evolutionary conservation when assessing functional importance

    • Integrate data across multiple experimental approaches

  • Causality vs. correlation:

    • In knockdown/knockout studies, establish clear links between SLC26A10 depletion and observed phenotypes

    • Include rescue experiments to confirm specificity of observed effects

    • Consider compensatory mechanisms (upregulation of other transporters)

  • Species differences:

    • Be cautious when extrapolating findings from model organisms to humans

    • Validate key findings in human cell lines or tissues when possible

    • Consider differences in tissue expression patterns between species

  • Data integration:

    • Combine structural predictions with functional data

    • Integrate transport measurements with physiological endpoints

    • Consider both in vitro and in vivo findings when available

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.