Recombinant Human Solute carrier family 35 member E2 (SLC35E2)

Shipped with Ice Packs
In Stock

Description

Introduction to SLC35E2

Recombinant Human SLC35E2 is a nucleotide sugar transporter belonging to the SLC35 family, which is critical for cellular glycosylation and metabolic regulation. The endogenous SLC35E2 protein facilitates the transport of nucleotide sugars (e.g., UDP-sugars) across intracellular membranes, enabling glycosylation processes in the Golgi apparatus and endoplasmic reticulum. Recombinant versions are engineered to study its function, localization, and role in diseases such as cancer.

Research Applications and Techniques

Recombinant SLC35E2 is utilized in diverse experimental workflows:

ApplicationMethodology
Antigen StandardServes as a control in ELISA for antibody validation
Protein LocalizationWestern Blot (WB) with SDS-PAGE; requires boiling lysates for membrane proteins
Interaction StudiesImmunoprecipitation (IP) to identify binding partners (e.g., KLF4)
Cancer ResearchXenograft models to study tumor growth and metastasis in ESCC
Regulatory MechanismsDual-luciferase assays to assess transcriptional regulation (e.g., Nrf2)

Key Findings:

  • Promoter Mutations: Hotspot mutations in the SLC35E2 promoter correlate with aggressive esophageal squamous cell carcinoma (ESCC), indicating its role as a prognostic biomarker .

  • KLF4 Interaction: KLF4 binds to the SLC35E2 promoter and represses its expression, while promoter mutations (-118 site) disrupt this repression, driving oncogenesis .

  • Oxidative Stress Regulation: In marine models, McSLC35E2 is negatively regulated by McNrf2, modulating antioxidant responses .

Role in Cancer

SLC35E2 is implicated in ESCC progression:

  1. Proliferation: Overexpression promotes cell proliferation in vitro and tumor growth in vivo .

  2. Epigenetic Regulation: KLF4-mediated repression is critical for maintaining normal cell function, and its disruption drives malignant phenotypes .

  3. Prognostic Value: Promoter mutations in SLC35E2 are linked to poor prognosis in ESCC patients, suggesting its utility as a therapeutic target .

Potential Therapeutic Targets

  • Antibody-Based Therapies: Recombinant SLC35E2 lysates enable the development of antibodies for targeted therapies .

  • Small-Molecule Inhibitors: Inhibiting SLC35E2 activity could block glycosylation-dependent cancer cell survival .

Functional Insights from Comparative Studies

While SLC35E2’s exact substrate remains unconfirmed, structural and functional studies of related SLC35 family members provide clues:

SLC35 MemberSubstrateBiological RoleDisease Link
SLC35A2UDP-GalGlycosylation in GolgiCongenital disorders (CDG-IIm)
SLC35A3UDP-GlcNAcGlycosaminoglycan synthesisChondrodysplasia
SLC35D3UDP-GlcDense granule formation in plateletsHermansky-Pudlak syndrome

SLC35E2’s substrate specificity requires further investigation but is hypothesized to involve nucleotide sugars critical for oncogenic pathways .

Challenges and Future Directions

  • Structural Characterization: Limited crystallographic data hinder mechanistic understanding of SLC35E2.

  • Translational Research: Validating SLC35E2 as a therapeutic target in ESCC requires clinical trials.

  • Cross-Species Insights: Studies in marine models (e.g., McSLC35E2 and McNrf2) highlight conserved regulatory pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize developing your specified tag.
Synonyms
SLC35E2A; SLC35E2; Solute carrier family 35 member E2A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC35E2
Target Protein Sequence
MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITE TTVIESDLGVWSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGC VKTLVPCCLYQHKARLSYPPNFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAP IFTVIMSRMILGEYTGRPSDREEREELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP GDFQVPQALHRVALSMALPCPMLPAS
Uniprot No.

Target Background

Function
Putative transporter.
Database Links

HGNC: 20863

KEGG: hsa:9906

STRING: 9606.ENSP00000246421

UniGene: Hs.655255

Protein Families
TPT transporter family, SLC35E subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SLC35E2?

SLC35E2 belongs to the solute carrier family 35, a group of membrane transporters primarily involved in the transport of nucleotide sugars from the cytoplasm to the lumen of the Golgi apparatus and/or endoplasmic reticulum (ER). While the specific substrate preference of SLC35E2 is still under investigation, other SLC35 family members transport various nucleotide sugars critical for glycosylation processes . Based on structural homology with characterized family members, SLC35E2 likely contributes to cellular glycosylation pathways by facilitating the transport of specific nucleotide sugar substrates across cellular membranes.

Where is SLC35E2 predominantly expressed in human tissues?

Expression analysis indicates that SLC35E2 has a tissue-specific expression pattern. While comprehensive expression data specifically for SLC35E2 continues to be developed, other SLC35 family members show variable expression across tissues. For instance, SLC35B1 is ubiquitously expressed in various tissues including the intestine . To determine the expression pattern of SLC35E2, researchers typically employ techniques such as qRT-PCR, western blotting, and immunohistochemistry across multiple tissue types, similar to the approaches used for SLC35A2 in colorectal cancer tissues .

How is SLC35E2 evolutionarily conserved across species?

The SLC35 family demonstrates strong evolutionary conservation across eukaryotes. Phylogenetic analyses have shown that certain subfamilies like SLC35B1 are conserved from plants and yeasts to humans . To investigate evolutionary conservation of SLC35E2 specifically, multiple sequence alignment tools can be employed to compare homologs across species, construct phylogenetic trees, and identify conserved functional domains. Sequence homology analysis would reveal the degree of conservation in the substrate-binding regions and transmembrane domains, providing insights into functional conservation throughout evolution.

How is SLC35E2 expression regulated under normal and stress conditions?

SLC35 family members show altered expression under various stress conditions. For example, expression of SLC35B1 increases under ER stress conditions in organisms ranging from Arabidopsis thaliana and Caenorhabditis elegans to mouse embryonic fibroblasts and human cells . To investigate SLC35E2 regulation:

  • Expose cell lines expressing SLC35E2 to various stressors (ER stress inducers, oxidative stress)

  • Measure changes in expression using qRT-PCR and western blotting

  • Perform promoter analysis to identify potential stress-responsive elements

  • Use chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the SLC35E2 promoter under stress conditions

This approach allows researchers to characterize the regulatory mechanisms controlling SLC35E2 expression in response to cellular stressors.

What transcription factors and epigenetic mechanisms regulate SLC35E2 expression?

Investigation of transcription factors and epigenetic regulation requires a multi-faceted approach:

  • In silico analysis of the SLC35E2 promoter region to identify potential transcription factor binding sites

  • Reporter assays using constructs containing the SLC35E2 promoter linked to luciferase

  • Site-directed mutagenesis of predicted binding sites to confirm functional relevance

  • DNA methylation analysis using bisulfite sequencing

  • Histone modification profiling through ChIP-seq experiments

Comparison with other SLC35 family members suggests potential involvement of ER stress-related transcription factors, as observed with SLC35B1 expression patterns under stress conditions .

What are the critical structural domains of SLC35E2 for its transport function?

Like other SLC35 family transporters, SLC35E2 likely contains multiple transmembrane domains forming a channel or pore through which substrates are transported. Critical structural analysis includes:

  • Prediction of transmembrane domains using bioinformatics tools

  • Site-directed mutagenesis of conserved residues predicted to be involved in substrate binding

  • Creation of chimeric proteins with other SLC35 family members to identify domains responsible for substrate specificity

  • Protein crystallography or cryo-EM studies to determine the three-dimensional structure

Studies of SLC35B1 suggest that nucleotide sugar transporters function as antiporters of nucleotide-sugar/nucleotide-monophosphate or potentially nucleotide-sugar/nucleotide-sugar . This mechanism could be explored for SLC35E2 through transport assays with radiolabeled substrates.

How does the substrate specificity of SLC35E2 compare to other SLC35 family members?

The SLC35 family shows diverse substrate preferences. For example, yeast SLC35B1 (HUT1) transports UDP-Gal but not UDP-Glc, while plant SLC35B1 (AtUTr1) transports both UDP-Gal and UDP-Glc . Human SLC35B1 (hUGTrel1) reportedly transports UDP-GlcA . To determine SLC35E2 substrate specificity:

  • Express recombinant SLC35E2 in a heterologous system (e.g., yeast mutants lacking endogenous transporters)

  • Prepare vesicles from expressing cells

  • Perform transport assays with various radiolabeled nucleotide sugars

  • Compare kinetic parameters (Km, Vmax) for different substrates

This methodological approach allows for comprehensive characterization of substrate preferences and transport kinetics.

What are the optimal conditions for expressing recombinant SLC35E2 protein?

Optimizing recombinant expression of membrane proteins like SLC35E2 requires systematic testing of expression systems:

  • Bacterial expression systems:

    • E. coli strains optimized for membrane proteins (C41, C43)

    • Expression as fusion proteins with solubility tags (MBP, SUMO)

    • Induction conditions: 16-18°C, low IPTG concentration (0.1-0.5 mM)

  • Eukaryotic expression systems:

    • Yeast (S. cerevisiae, P. pastoris) - particularly useful as they can perform eukaryotic post-translational modifications

    • Insect cells (Sf9, Hi5) with baculovirus vectors

    • Mammalian cells (HEK293, CHO)

  • Cell-free expression systems:

    • Wheat germ extract

    • E. coli extract supplemented with lipids or detergents

For each system, optimization of parameters including temperature, induction time, and detergent for extraction should be performed. Based on studies with other SLC35 family members, eukaryotic systems often provide better functional expression of these transporters .

What methods are most effective for analyzing SLC35E2 subcellular localization?

To determine the subcellular localization of SLC35E2:

  • Fluorescent protein tagging:

    • Generate fusion constructs with fluorescent proteins (GFP, mCherry)

    • Express in mammalian cells

    • Co-localize with organelle markers (e.g., ER markers like SP12, Golgi markers)

  • Immunofluorescence microscopy:

    • Develop specific antibodies against SLC35E2

    • Use established organelle markers for co-localization

    • Apply high-resolution techniques (confocal, STED, STORM)

  • Subcellular fractionation:

    • Perform differential centrifugation to isolate cellular compartments

    • Analyze fractions by western blotting

    • Compare distribution with established organelle markers

Based on studies with SLC35B1, which localizes to the ER , SLC35E2 may also reside in the ER or Golgi apparatus. The approach using EGFP-tagged constructs, similar to those used for SLC35B1 (HUT-1) in C. elegans studies, provides an effective method for visualization .

How can transport activity of SLC35E2 be measured in vitro?

Measuring transport activity requires preparation of membrane vesicles or proteoliposomes:

  • Membrane vesicle transport assays:

    • Express SLC35E2 in appropriate host cells

    • Prepare membrane vesicles by homogenization and differential centrifugation

    • Incubate vesicles with radiolabeled nucleotide sugars

    • Measure uptake using rapid filtration technique

  • Reconstitution in proteoliposomes:

    • Purify SLC35E2 protein in detergent

    • Reconstitute into artificial liposomes

    • Measure transport of radiolabeled substrates

    • Determine kinetic parameters (Km, Vmax)

  • Indirect measurement in cellular systems:

    • Use glycosylation-deficient cells

    • Complement with SLC35E2 expression

    • Analyze restoration of glycosylation by glycan analysis

For data analysis, transport kinetics can be plotted using Michaelis-Menten or Lineweaver-Burk plots to determine transport affinity and capacity.

What is the relationship between SLC35E2 mutations and human diseases?

While specific disease associations for SLC35E2 are still being established, other SLC35 family mutations cause various hereditary diseases due to impaired oligosaccharide synthesis . To investigate potential disease associations:

  • Genetic screening:

    • Sequence SLC35E2 in patients with unexplained glycosylation disorders

    • Perform whole exome sequencing in families with potential metabolic or developmental disorders

    • Analyze GWAS data for SNPs associated with SLC35E2

  • Functional characterization of identified variants:

    • Express variant proteins in cellular models

    • Measure transport activity

    • Assess effects on glycosylation pathways

  • Animal models:

    • Generate knockout or knockin mice carrying human mutations

    • Characterize phenotypes focusing on glycosylation-dependent processes

This multi-layered approach would help establish connections between SLC35E2 variants and potential disease phenotypes.

How might SLC35E2 contribute to cancer pathogenesis?

Recent studies have shown that SLC35A2 is upregulated in colorectal cancer and related to tumor pathological stage and lymph node metastasis . Similar investigations for SLC35E2 would involve:

  • Expression analysis in cancer tissues:

    • Compare SLC35E2 expression levels between tumor and adjacent normal tissues

    • Correlate expression with clinical parameters (stage, grade, metastasis)

    • Perform survival analysis to determine prognostic significance

  • Functional studies in cancer cell lines:

    • Knockdown or overexpress SLC35E2

    • Measure effects on proliferation, migration, invasion

    • Analyze changes in glycosylation patterns of cancer-related proteins

  • Mechanistic investigations:

    • Identify glycoproteins affected by SLC35E2 activity

    • Determine signaling pathways impacted

    • Evaluate potential as a therapeutic target

Similar to the approach used for SLC35A2 , a combination of bioinformatic analysis of cancer databases, experimental validation, and functional characterization would provide insights into SLC35E2's role in cancer.

How can CRISPR/Cas9 genome editing be optimized for studying SLC35E2 function?

CRISPR/Cas9 offers powerful tools for manipulating SLC35E2:

  • Knockout studies:

    • Design multiple gRNAs targeting conserved exons

    • Screen edited clones using PCR, sequencing, and western blotting

    • Validate knockout phenotype with rescue experiments

  • Knockin of reporter tags:

    • Design homology-directed repair templates with fluorescent tags

    • Create endogenously tagged SLC35E2 for localization studies

    • Ensure tag placement doesn't interfere with function

  • Base editing for specific mutations:

    • Use cytosine or adenine base editors for precise nucleotide changes

    • Create disease-associated variants for functional studies

  • CRISPRi/CRISPRa for expression modulation:

    • Design gRNAs targeting promoter regions

    • Use dCas9-KRAB for repression or dCas9-VP64 for activation

    • Create cellular models with tunable SLC35E2 expression

When designing CRISPR experiments, consider the potential for off-target effects and include appropriate controls, such as rescue experiments with wild-type SLC35E2 expression.

What proteomics approaches can reveal SLC35E2 interaction partners?

Identifying protein-protein interactions requires multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged SLC35E2 (FLAG, HA, BioID)

    • Perform mild solubilization with appropriate detergents

    • Immunoprecipitate complexes and analyze by LC-MS/MS

    • Compare with appropriate controls to filter non-specific interactions

  • Proximity labeling approaches:

    • Fusion with BioID or APEX2 enzymes

    • Biotin labeling of proximal proteins

    • Streptavidin pulldown and mass spectrometry

    • Particularly useful for membrane proteins like SLC35E2

  • Crosslinking mass spectrometry:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest and identify crosslinked peptides by MS

    • Map interaction interfaces

  • Split-protein complementation assays:

    • Validate specific interactions identified by proteomics

    • Use split-GFP, split-luciferase, or BRET approaches

    • Determine subcellular localization of interactions

These techniques would help establish the SLC35E2 interactome and provide insights into its functional relationships within cellular networks.

How can transcriptomic data be used to identify potential functions of SLC35E2?

Gene expression data analysis offers powerful insights into gene function:

  • Co-expression network analysis:

    • Analyze public microarray and RNA-seq datasets

    • Identify genes consistently co-expressed with SLC35E2

    • Construct gene networks using WGCNA or similar approaches

    • Determine functional modules containing SLC35E2

  • Differential expression analysis under perturbations:

    • Compare expression patterns after knockdown/overexpression

    • Identify pathways affected by SLC35E2 modulation

    • Use Gene Set Enrichment Analysis (GSEA) to identify enriched pathways

  • Single-cell RNA-seq analysis:

    • Determine cell type-specific expression patterns

    • Identify potential cell-specific functions

    • Map expression to developmental trajectories

  • Integration with epigenomic data:

    • Correlate expression with chromatin accessibility data

    • Identify potential regulatory elements controlling SLC35E2 expression

    • Map transcription factor binding sites

This multi-omics approach, similar to that used in analysis of metabolic disorders , provides a comprehensive understanding of SLC35E2's regulatory network and potential functions.

How should researchers address contradictory findings in SLC35E2 functional studies?

Addressing contradictory results requires systematic analysis:

  • Experimental system differences:

    • Compare cell lines, expression systems, and experimental conditions

    • Consider species differences in ortholog functions

    • Validate findings across multiple experimental systems

  • Methodology assessment:

    • Evaluate sensitivity and specificity of assays used

    • Consider technical limitations of each approach

    • Develop alternative assays to validate findings

  • Reconciliation strategies:

    • Systematically test hypotheses explaining discrepancies

    • Consider context-dependent functions

    • Design experiments with appropriate positive and negative controls

  • Meta-analysis approaches:

    • Compile all available data in standardized format

    • Apply statistical methods to identify sources of variability

    • Weight evidence based on methodological rigor

FactorPotential Impact on ResultsMitigation Strategy
Expression systemDifferential post-translational modificationsCompare results across multiple systems (bacterial, yeast, mammalian)
Substrate concentrationSaturation effects, non-specific transportPerform kinetic analysis with concentration gradients
Detergent selectionProtein stability, activity maintenanceScreen multiple detergents for optimal activity retention
Cell typeEndogenous transport systemsUse knockout cell lines lacking endogenous transporters
Tag positionInterference with functionCompare N- and C-terminal tags, use small epitope tags

This structured approach allows researchers to systematically address contradictions and develop a consensus understanding of SLC35E2 function.

What emerging technologies will advance our understanding of SLC35E2 function?

Several cutting-edge approaches show promise for SLC35E2 research:

  • Cryo-electron microscopy:

    • Determine high-resolution structures in different conformational states

    • Map substrate binding sites

    • Understand transport mechanism at molecular level

  • Advanced live-cell imaging:

    • Super-resolution microscopy to visualize subcellular localization

    • FRET sensors to monitor transport activity in real-time

    • Optogenetic tools to control SLC35E2 activity with light

  • Single-molecule approaches:

    • Fluorescence correlation spectroscopy to analyze diffusion dynamics

    • Single-molecule FRET to detect conformational changes

    • Patch-clamp fluorometry to correlate structure and function

  • Organoid models:

    • Study SLC35E2 function in physiologically relevant 3D tissue models

    • Analyze cell type-specific functions

    • Test effects of genetic variants in human-derived systems

These technologies will provide unprecedented insights into SLC35E2 dynamics and function in increasingly complex and physiologically relevant systems.

How can multi-omics data integration improve our understanding of SLC35E2 in cellular homeostasis?

Multi-omics integration offers a systems biology perspective:

  • Data types to integrate:

    • Transcriptomics: gene expression changes upon SLC35E2 modulation

    • Proteomics: protein abundance and post-translational modifications

    • Glycomics: changes in cellular glycan profiles

    • Metabolomics: nucleotide sugar levels and other metabolites

    • Interactomics: protein-protein interaction networks

  • Integration approaches:

    • Pathway-level integration using known biological networks

    • Machine learning methods to identify patterns across datasets

    • Causal inference methods to determine directionality of effects

    • Network-based approaches to identify regulatory modules

  • Computational tools:

    • Multi-omics factor analysis (MOFA)

    • Similarity network fusion (SNF)

    • Joint dimension reduction methods

    • Bayesian network modeling

This integrative approach, exemplified by studies on other metabolic disorders , provides a comprehensive view of how SLC35E2 influences cellular processes across multiple molecular levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.