Recombinant Human Solute carrier family 35 member G4 (SLC35G4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
SLC35G4; AMAC1L1; SLC35G4P; Putative solute carrier family 35 member G4; Acyl-malonyl-condensing enzyme 1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SLC35G4
Target Protein Sequence
MAGSHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGFVGPLSRM AYQASNLPSLELVICRCLFHLPIALLLKLRGDPLLGPPDIRGRTCFCALLNVLNIGCAYS AVQVVPTGNAATVRKHSSTVCSAILTLCLESQVLSGYDWCGLLGSILGLIIIVGPGLWTL QEGTTGVYTGLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGSVPGLFV LQSPVLPSDLLSWSCVGAVGILTLVSFTCVGYAVTKAHPALVCAVLHSEVVMALILQYFM LHETVAPSDIMGAGVVLGSIAIITARNLICERTGKVEE
Uniprot No.

Target Background

Database Links

HGNC: 31043

KEGG: hsa:646000

Protein Families
SLC35G solute transporter family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context and basic structure of SLC35G4?

SLC35G4 (solute carrier family 35 member G4) is a protein-coding gene located on chromosome 18p11.21. The gene spans the genomic sequence from positions 11,609,596 to 11,610,612 on chromosome 18 (according to reference sequence NC_000018.10). It has a relatively simple structure consisting of only 1 exon . The gene is also known by alternative names including AMAC1L1 and SLC35G4P .

SLC35G4 belongs to the broader solute carrier family 35 (SLC35) gene group, which contains numerous members involved in the transport of nucleotide sugars, nucleotide sulfates, and other molecules across cellular membranes . The protein encoded by SLC35G4 is predicted to be active in membrane functions, according to information provided by the Alliance of Genome Resources .

What is the expression profile of SLC35G4 across different human tissues?

Based on data from the Human Protein Atlas, SLC35G4 shows a variable expression pattern across human tissues. While the protein atlas contains comprehensive information on tissue expression for many proteins, the specific expression profile for SLC35G4 indicates it is not uniformly expressed across all tissues .

The expression profiling data suggests that SLC35G4 may have tissue-specific functions, though detailed quantitative information about its expression levels in specific tissues requires further investigation. Researchers interested in the tissue-specific roles of SLC35G4 should consider conducting RNA-seq or quantitative PCR analyses to validate expression patterns in their tissues of interest.

How is SLC35G4 related to other members of the solute carrier family?

SLC35G4 is part of the larger solute carrier (SLC) superfamily, specifically belonging to the SLC35 subfamily. The SLC35 gene group encodes nucleotide sugar transporters that play crucial roles in glycosylation pathways .

Protein interaction analysis via STRING database shows that SLC35G4 has predicted functional partnerships with several other solute carriers, with the strongest associations being:

Protein PartnerDescriptionInteraction Score
SLC35E2ASolute carrier family 35 member E2A; Putative transporter0.545
SLC35E2BSolute carrier family 35 member E2B; Putative transporter0.544
SLC25A52Solute carrier family 25 member 520.518
SLCO1B7Solute carrier organic anion transporter family member 1B70.505

These interactions suggest that SLC35G4 may participate in related transport functions and potentially shares regulatory mechanisms with these proteins .

What experimental approaches are optimal for studying SLC35G4 function in cellular systems?

To effectively study SLC35G4 function, researchers should consider a multi-faceted experimental approach:

  • CRISPR/Cas9 Gene Editing: This approach has been successfully used to generate SLC35G4 knockout cells, allowing for the study of protein function through loss-of-function experiments. The methodology includes:

    • Design of specific sgRNAs targeting SLC35G4

    • PCR validation of edited alleles

    • Sequence verification using Sanger sequencing or MiSeq

    • Functional validation through cellular assays

  • Recombinant Protein Expression: For studying protein interactions and biochemical properties:

    • Molecular cloning of SLC35G4 into appropriate expression vectors (e.g., pLJM1 backbone)

    • Addition of epitope tags (e.g., 3xHA) via Gibson assembly

    • Expression in mammalian cell lines followed by validation via Western blotting

  • Metabolomics Analysis: Given SLC35G4's role as a transporter, metabolomics approaches can be valuable:

    • LC-MS based metabolite profiling

    • Sample preparation optimization for reproducibility

    • Appropriate normalization strategies to adjust for unwanted variability

    • Statistical analysis using multivariate approaches such as PCA

When designing these experiments, researchers should implement randomized block designs with appropriate replication to control for non-experimental variance, as emphasized in the experimental design literature 7.

How does SLC35G4 contribute to cellular protection against oxidative stress?

Recent research has revealed that SLC35G4 plays a significant role in cellular protection against oxidative stress. The SLC35G4 gene encodes two distinct proteins: the canonical SLC35G4 and an alternative protein called AltSLC35A4, which is translated from an upstream ORF (uORF) in the SLC35G4 mRNA .

The mechanisms through which SLC35G4 contributes to oxidative stress protection include:

  • AltSLC35A4 Mitochondrial Localization: The alternative protein encoded by SLC35G4 (AltSLC35A4) is a transmembrane protein localized to the inner mitochondrial membrane, suggesting a direct role in mitochondrial function during stress responses .

  • Stress-Induced Translation Regulation: During oxidative stress induced by sodium arsenite (SA), the translation of SLC35G4 undergoes one of the greatest increases in translational efficiency among all cellular mRNAs, indicating its importance in stress response pathways .

  • Stress-Induced Expression of Novel Isoforms: Under oxidative stress conditions, the presence of the upstream ORF leads to the expression of novel short isoforms of SLC35G4, suggesting a stress-specific regulatory mechanism .

  • Protection Independent of Short Isoforms: Experimental evidence using CRISPR/Cas9-generated SLC35G4 knockout cells demonstrates that SLC35G4 expression is necessary for protection against sodium arsenite-induced oxidative stress, independent from the short isoforms .

Researchers investigating these mechanisms should consider employing oxidative stress assays with sodium arsenite treatment, combined with transcriptomics and proteomics approaches to fully understand the regulatory networks involved.

What evidence exists for evolutionary selection acting on SLC35G4?

Genomic analysis has revealed that SLC35G4 shows strong signals of balancing selection, particularly in African populations. This finding is significant as it suggests that maintaining genetic diversity at this locus has been evolutionarily advantageous .

Key findings regarding evolutionary selection on SLC35G4 include:

  • Strong Balancing Selection Signal: SLC35G4 has the second strongest selection signal in African populations (LD-ABF score of 0.65) and is among the top 100 genes showing balancing selection signals across all populations studied .

  • Novel Selection Signature: This selection signal in SLC35G4 is described as novel, suggesting it had not been previously identified in evolutionary studies .

  • Consistent Selection Across Populations: SLC35G4 is one of nine genes shared among the top selection signals across all populations studied (African, American, East Asian, European, and South Asian), indicating its evolutionary importance is not limited to specific ancestral groups .

  • Potential Functional Relevance: While the specific selective pressures acting on SLC35G4 remain unknown, its identification among genes under balancing selection suggests it may play important roles in immune response, environmental adaptation, or other fitness-related functions .

To further investigate the evolutionary significance of SLC35G4, researchers should consider population genetics approaches, including haplotype analysis, extended haplotype homozygosity tests, and comparative genomics across diverse human populations and related species.

How can researchers optimize experimental design for studying SLC35G4 interactions with other cellular components?

Optimizing experimental design for studying SLC35G4 interactions requires careful consideration of several methodological aspects:

  • Statistical Power and Sample Size Determination:

    • Conduct power analysis to determine appropriate sample sizes

    • Consider effect size, variability, and desired statistical power (typically 1-β, where β is the false negative rate)

    • For comparing multiple groups (e.g., different SLC35G4 variants), more replicates are typically required

  • Randomization and Blocking Strategies:

    • Implement randomized block designs to reduce non-experimental variance

    • Randomize sample processing and acquisition order to distribute error

    • Use appropriate randomization techniques rather than haphazard reordering

  • Automated Experimental Design (Auto-EXD):

    • Consider novel approaches like Auto-EXD which evaluates candidate designs by simulating experiments based on historical control data

    • This approach can reduce estimation error of treatment effects by up to 25% compared to standard designs

  • Multi-omics Integration:

    • Design integrated experiments that combine proteomics, genomics, and metabolomics

    • Ensure equivalent conditions across different omics platforms

    • Leverage correlations across multiple omics to increase confidence in results

  • Normalization Strategies:

    • Choose appropriate normalization methods based on specific experimental conditions

    • Be aware that each normalization makes different assumptions about the sample

    • Consider that normalization can be sensitive to missing values and is not always necessary

When studying SLC35G4 interactions specifically, researchers should pay particular attention to membrane preparation protocols given its predicted membrane localization, and consider proximity-based approaches like BioID or APEX to identify interacting partners in their native cellular context.

What role does SLC35G4 play in cancer development and progression?

Recent research suggests that SLC35G4 may have significant implications in cancer biology, particularly in gastric cancer (GC). The findings demonstrate a novel regulatory relationship between SLC35G4 and the Hippo pathway effector YAP1 .

Key findings regarding SLC35G4's role in cancer include:

  • YAP1-Mediated Regulation: SLC35G4 has been identified as a direct transcriptional target of the YAP1-TEADs complex in gastric cancer cells, as demonstrated through cDNA arrays, promoter reporter assays, and chromatin immunoprecipitation .

  • Essential Role in Cancer Cell Survival: Functional studies utilizing CCK-8, plate colony formation, and soft agar assays have revealed that SLC35G4 is essential for the survival and proliferation of gastric cancer cells both in vitro and in nude mice models .

  • Elevated Expression in Tumor Tissues: SLC35G4 expression is markedly higher in gastric cancer tissues compared to adjacent non-cancerous tissues .

  • Correlation with YAP1 Expression: Immunohistochemistry analysis has shown that SLC35G4 expression positively correlates with YAP1 expression in human gastric cancer tissues, a correlation that is further confirmed in the TCGA gastric cancer dataset .

  • Prognostic Significance: Gastric cancer patients with high levels of SLC35G4 expression demonstrate poorer prognosis compared to those with low expression levels, suggesting its potential as a prognostic marker .

  • Potential as Neoantigen: In addition to its role in gastric cancer, SLC35G4 has been described as a potential neoantigen in prostate cancer, suggesting broader implications across cancer types .

These findings collectively indicate that SLC35G4 functions as an important downstream oncogenic target of YAP1, and that the YAP1/SLC35G4 regulatory axis may contribute significantly to gastric cancer development and progression, potentially serving as a target for therapeutic intervention.

How does the solute carrier family 35 (SLC35) gene group function in normal cellular physiology?

The solute carrier family 35 (SLC35) gene group encodes nucleotide sugar transporters that play essential roles in normal cellular physiology, particularly in glycosylation pathways. Understanding the broader context of this family helps position SLC35G4's specific functions:

  • Nucleotide Sugar Transport: SLC35 transporters facilitate the movement of nucleotide sugars from the cytoplasm to the lumen of the endoplasmic reticulum and Golgi apparatus, where they serve as substrates for glycosylation reactions .

  • Glycosylation Processes: These transporters are critical for the glycosylation of biological macromolecules, including proteins and lipids, which affects protein folding, stability, and function .

  • Specific Transport Functions: Different members of the SLC35 family transport specific nucleotide sugars. For instance, SLC35B4 specifically transports UDP-xylose and UDP-GlcNAc .

  • Subcellular Localization: SLC35 transporters are typically localized to the membranes of the ER, Golgi apparatus, or other organelles, positioning them to facilitate specific glycosylation events in these compartments .

  • Tissue-Specific Expression Patterns: Members of the SLC35 family often show tissue-specific expression patterns, suggesting specialized roles in different physiological contexts .

  • Disease Associations: Mutations or dysregulation of SLC35 family genes have been implicated in various diseases, including cancer and congenital disorders of glycosylation .

For SLC35G4 specifically, while its exact substrate specificity remains to be fully characterized, its membership in this family suggests it likely plays a role in nucleotide sugar transport and consequent glycosylation processes. The evolutionary conservation and selection signals observed for SLC35G4 further emphasize its likely importance in fundamental cellular processes .

What methodological challenges exist in investigating the dual coding properties of the SLC35G4 gene?

The SLC35G4 gene exhibits dual coding properties, encoding both the canonical SLC35G4 protein and an alternative protein called AltSLC35A4 from an upstream open reading frame (uORF). Investigating this dual coding phenomenon presents several methodological challenges:

  • Differential Detection of Protein Isoforms:

    • Western blotting conditions must be optimized differently for the two proteins

    • AltSLC35A4 requires specific transfer conditions (0.15A in 20% MeOH for 2 hours onto PVDF membrane)

    • Different antibody incubation protocols are needed (overnight blocking for AltSLC35A4 versus 1 hour for standard proteins)

  • Subcellular Localization Studies:

    • Different fixation and permeabilization protocols may be required to study the distinct subcellular localizations (membrane versus mitochondrial)

    • Microscopy approaches must account for potential overlapping signals from the two protein products

    • Colocalization studies require careful selection of organelle markers

  • Functional Dissection of Individual Protein Contributions:

    • Targeted mutations that affect one protein without disturbing the other require precise genetic engineering

    • CRISPR/Cas9 strategies must be carefully designed to create specific knockout models

    • Rescue experiments must incorporate controls for both protein products

  • Stress-Responsive Translation Dynamics:

    • Studying stress-induced changes in translation requires specialized techniques like ribosome profiling

    • Temporal dynamics of translation shifting between the canonical and alternative ORFs necessitates time-course analyses

    • Quantification of translational efficiency changes requires normalization to appropriate reference genes

  • Biochemical Characterization of Membrane Proteins:

    • Purification of membrane proteins requires specialized detergent-based protocols

    • Functional reconstitution studies are technically challenging

    • The inner mitochondrial membrane localization of AltSLC35A4 presents additional purification challenges

Researchers investigating the dual coding properties of SLC35G4 should carefully optimize their experimental approaches to address these challenges, potentially utilizing a combination of genetic engineering, proteomic analyses, and functional assays to disentangle the respective roles of the two protein products.

How can researchers effectively validate potential SLC35G4 variants identified in genomic studies?

Validation of SLC35G4 variants identified in genomic studies requires a systematic approach that combines multiple methods:

  • Sanger Sequencing Validation:

    • Design primers flanking the variant of interest

    • PCR amplify the region from genomic DNA

    • Perform bidirectional Sanger sequencing

    • Compare chromatogram results with reference sequence

  • High-Throughput Validation:

    • For multiple variants, consider targeted next-generation sequencing panels

    • Use amplicon-based approaches like MiSeq for validation of multiple samples

    • Implement appropriate bioinformatics pipelines for variant calling

  • Functional Validation:

    • Generate expression constructs containing wild-type and variant sequences

    • Introduce variants using site-directed mutagenesis

    • Express recombinant proteins in appropriate cell systems

    • Assess functional consequences through relevant assays

  • Population Frequency Analysis:

    • Compare variant frequencies with population databases (gnomAD, 1000 Genomes)

    • Assess whether variant frequencies align with evolutionary selection patterns

    • Consider population-specific analyses for variants showing strong selection signals

  • Computational Prediction:

    • Utilize multiple in silico prediction tools to assess variant impact

    • Consider conservation, protein structure, and functional domains

    • Integrate different prediction algorithms for consensus scoring

  • Experimental Validation Plan:

Validation LevelMethodsOutcome Measures
GenomicSanger sequencing, Digital PCRConfirmation of variant presence
TranscriptomicRT-PCR, RNA-seqEffect on mRNA expression/splicing
ProteomicWestern blot, Mass spectrometryEffect on protein expression/structure
FunctionalCell-based assays, transport assaysImpact on biological function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.