Recombinant Human Somatostatin receptor type 1 (SSTR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Somatostatin Receptor Type 1

Somatostatin Receptor Type 1 (SSTR1) belongs to a family of G protein-coupled receptors that mediate the biological effects of somatostatin, a peptide hormone with two active forms consisting of 14 and 28 amino acids . Somatostatin regulates diverse cellular functions including neurotransmission, cell proliferation, and endocrine signaling while inhibiting the release of numerous hormones and secretory proteins . The somatostatin receptor family comprises five distinct subtypes (SSTR1-5), each with unique tissue distribution patterns and signaling properties .

Recombinant expression systems have revolutionized the study of SSTR1 by enabling researchers to produce large quantities of the receptor in controlled laboratory conditions. These recombinant systems facilitate detailed investigations of receptor pharmacology, signal transduction mechanisms, and structural characteristics that would otherwise be challenging to study in native tissues. Recombinant SSTR1 has become an invaluable tool for high-throughput screening of potential therapeutic compounds and for understanding the molecular basis of somatostatin action .

Molecular Structure and Characteristics of SSTR1

SSTR1 is characterized by its seven-transmembrane segment structure, typical of G protein-coupled receptors . The human SSTR1 gene is located on chromosome 14 and encodes a protein with alternative nomenclature including SRIF-2, SS1-R, SS1R, and SS-1-R . The receptor exhibits distinctive binding properties, with higher affinity for somatostatin-14 compared to somatostatin-28, suggesting specialized physiological roles for this receptor subtype .

An important structural feature of SSTR1 is its ability to form homodimers with itself and heterodimers with other members of the somatostatin receptor family as well as with other G protein-coupled receptors and receptor tyrosine kinases . This oligomerization capability significantly impacts the receptor's pharmacological properties and signaling efficacy, providing multiple levels of regulation for somatostatin action.

Recent cryo-electron microscopy (cryo-EM) studies have revealed the three-dimensional structure of SSTR1 in complex with various ligands, including the selective agonist L-797591 . These structures have provided unprecedented insights into the conformational changes associated with receptor activation and the molecular determinants of ligand selectivity across different somatostatin receptor subtypes .

Expression and Distribution in Tissues

SSTR1 displays a tissue-specific expression pattern that correlates with its specialized physiological functions . The receptor is abundantly expressed in the central nervous system, particularly in the hippocampus, hypothalamus, basal ganglia, and retina, where it functions as an inhibitory autoreceptor on somatostatin neurons . This distribution suggests important roles in neuronal regulation and potentially in neurological disorders.

Gene expression profiling data from the Allen Brain Atlas indicates differential expression of SSTR1 across various brain regions, with particularly high expression in specific nuclei . Beyond the central nervous system, SSTR1 is also expressed in peripheral tissues and certain tumor types, supporting its involvement in both normal physiology and pathological conditions.

In recombinant expression systems, stable cell lines have been developed that ensure high-level surface expression of SSTR1, making them valuable tools for pharmacological studies and drug screening . These systems typically utilize mammalian cell lines such as Chinese hamster lung fibroblast cells (CCL39), which provide an appropriate cellular environment for proper receptor folding, post-translational modifications, and trafficking to the cell membrane .

Signaling Mechanisms and Functional Properties

SSTR1 primarily couples to pertussis toxin-sensitive G proteins (Gi/Go) to inhibit adenylyl cyclase activity, resulting in decreased intracellular cyclic adenosine monophosphate (cAMP) levels . This classical inhibitory signaling pathway contributes to the suppression of hormone secretion, which represents one of the principal physiological effects of somatostatin .

Beyond cAMP inhibition, SSTR1 also activates additional signaling cascades, including stimulation of phosphotyrosine phosphatase and Na+/H+ exchanger via pertussis toxin-insensitive G proteins . This signaling versatility enables SSTR1 to regulate multiple cellular processes, including cell proliferation, differentiation, and migration.

A distinctive feature of SSTR1 signaling is its unique guanine nucleotide sensitivity profile. Experimental studies with the stable GTP analogue guanylylimidodiphosphate (GppNHp) have shown that SSTR1 exhibits relatively low sensitivity to guanine nucleotides compared to other somatostatin receptor subtypes . This characteristic suggests that SSTR1 may maintain more stable ligand-receptor complexes and potentially prolonged signaling responses compared to other receptor subtypes.

Pharmacological Profiling and Ligand Binding

Detailed pharmacological characterization of recombinant SSTR1 has been performed using various radioligands, including [125I]LTT-SRIF28, [125I][Tyr10]CST14, [125I]CGP 23996, and [125I][Tyr3]octreotide . These studies have revealed that SSTR1 binds these ligands with high affinity and in a saturable manner, typical of specific receptor-ligand interactions.

Binding studies with [125I]-somatostatin-14 have established a dissociation constant (Kd) of approximately 1.4 nM for recombinant human SSTR1 . At a concentration of 0.5 nM [125I]-somatostatin-14, membrane preparations containing 5 μg/well of recombinant SSTR1 yield greater than 12-fold signal-to-background ratio, demonstrating excellent performance in radioligand binding assays .

Table 1: Binding Parameters of Radioligands to Recombinant Human SSTR1

RadioligandBinding Affinity (Kd)Maximum Binding (Bmax)Guanine Nucleotide Sensitivity
[125I]LTT-SRIF28High affinityEquivalent across SSTR1-4Low sensitivity to GppNHp
[125I][Tyr10]CST14High affinityEquivalent across SSTR1-4Low sensitivity to GppNHp
[125I]CGP 23996High affinityEquivalent across SSTR1-4Low sensitivity to GppNHp
[125I][Tyr3]octreotideHigh affinityEquivalent across SSTR1-4Low sensitivity to GppNHp
[125I]-somatostatin-141.4 nMSaturable bindingNot specified

The differences in guanine nucleotide sensitivity of agonist binding to SSTR1 compared to other somatostatin receptor subtypes suggest the existence of multiple agonist-specific receptor states that vary from one receptor subtype to another . This pharmacological diversity cannot be fully explained by the traditional ternary complex model or its variations, indicating a more complex mechanism of receptor activation and signaling .

Recombinant Expression Systems for SSTR1

The development of stable recombinant cell lines expressing human SSTR1 has been crucial for detailed pharmacological and functional studies . These expression systems typically utilize mammalian host cells such as Chinese hamster lung fibroblast cells (CCL39) to ensure proper post-translational modifications and membrane localization of the receptor .

Recombinant SSTR1 expression systems have been optimized to achieve high-level surface expression, making them ideal for high-throughput screening applications . Membrane preparations from these cell lines contain functional receptors that retain their native binding and signaling properties, as evidenced by their ability to bind somatostatin with high affinity and couple to appropriate G proteins .

Table 2: Characteristics of Recombinant SSTR1 Expression Systems

Expression SystemHost Cell LineReceptor DensityApplicationsReference
Stable transfectionCCL39 (Chinese hamster lung fibroblast)HighRadioligand binding assays, Functional studies
Proprietary stable cell linesNot specifiedHigh surface expressionHigh-throughput screening

These recombinant expression systems have enabled detailed characterization of SSTR1 pharmacology and signaling, facilitating the development of subtype-selective ligands and enhancing our understanding of receptor function in both physiological and pathological contexts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SSTR1; Somatostatin receptor type 1; SS-1-R; SS1-R; SS1R; SRIF-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Uniprot No.

Target Background

Function
Somatostatin receptor type 1 (SSTR1) exhibits higher affinity for somatostatin-14 than somatostatin-28. This receptor couples to pertussis toxin-sensitive G proteins, inhibiting adenylyl cyclase. Additionally, it activates phosphotyrosine phosphatase and the Na+/H+ exchanger via pertussis toxin-insensitive G proteins.
Gene References Into Functions

SSTR1 Function and Clinical Significance:

  1. High SSTR1 expression correlates with hepatocellular and cholangiocellular carcinomas in tumor capillaries. PMID: 29282035
  2. Pancreatic neuroendocrine tumors (PNETs) demonstrate variable SSTR subtype expression: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%). PMID: 26474434
  3. Immunohistochemical studies have investigated the expression of somatostatin receptor subtypes. PMID: 25962406
  4. The UMB-7 antibody aids in identifying sst1-expressing tumors, facilitating diagnostic and therapeutic interventions. PMID: 23466804
  5. Somatostatin receptor PET (SSTR-PET), especially in conjunction with CT, enhances the sensitivity of imaging bone, soft tissue, and brain metastases, influencing clinical staging and patient management. PMID: 24742330
  6. SSTRs show overexpression in primary pigmented nodular adrenocortical disease tissues compared to the normal adrenal cortex. PMID: 24512486
  7. Activated/phosphorylated pMAPK 44/42 is detected in a significant proportion of medulloblastomas and primitive neuroectodermal tumors, often with coexpression of SSTR1. PMID: 23455179
  8. Somatostatin receptor imaging (SRI) using SPECT or PET plays a crucial role in managing neuroendocrine tumors. PMID: 24106690
  9. Advanced-stage hepatocellular carcinoma exhibits high SSTR1 and SSTR5 expression in tumor cells. PMID: 24634938
  10. Somatostatin receptor 1 is a methylated gene in EBV-infected gastric cancer cells, potentially acting as a tumor suppressor. PMID: 23722468
  11. SSTR1 or SSTR1/5 transfection negatively regulates EGF-mediated effects by inhibiting EGFR phosphorylation. PMID: 21419811
  12. SSTR1, SSTR2, SSTR3, and SSTR5 mRNA levels are elevated in PET compared to AC, while SSTR4 expression is low in both. PMID: 20717067
  13. Further research is needed to elucidate the roles of SSTR1-5 in diabetes. PMID: 20182388
  14. SSTR1 is overexpressed in endometrium in endometriosis. PMID: 20739383
  15. In neuroendocrine tumors, SSTR expression patterns show a prevalence of SSTR1 > SSTR5 > SSTR3 > SSTR2A > SSTR2B. PMID: 20529830
  16. Higher SSTR1 expression correlates with normalized GH and IGF-I levels and tumor reduction by octreotide-LAR. PMID: 19330452
  17. SSTR1 is expressed in retroorbital fibroblasts, and octreotide inhibits their growth in Graves' disease. PMID: 11753241
  18. SSTRs 1-5 exhibit heterogeneous expression in gastroenteropancreatic endocrine tumors. PMID: 12021920
  19. Selective SSTR1 activation reduces cell growth and calcitonin secretion in medullary thyroid carcinoma cell lines. PMID: 12359227
  20. Studies examine the expression of somatostatin (SS) and SS receptor (SSR) subtypes 1, 2A, and 3 in normal human thymic tissue. PMID: 12376335
  21. Lymphocytes from Graves' ophthalmopathy tissues and blood samples express SSTR transcripts, with higher levels of SST1, -2, and -4 mRNA. PMID: 12414882
  22. SSTR1 localization and expression are studied in human prostatic tissue and prostate cancer cell lines. PMID: 12474541
  23. SSTR1-selective activation inhibits hormone secretion and cell viability in GH- and PRL-secreting pituitary adenomas. PMID: 12788890
  24. Heterodimeric assembly of hSSTR1 does not require its activation. PMID: 15247250
  25. Transcriptional regulation of human SST1 is investigated. PMID: 17533578
  26. Upregulation of SSTR1 and -2 is observed in orbital tissues of Graves' ophthalmopathy patients, potentially linked to adipogenesis. PMID: 17848636
  27. SSTR1 and genes related to proliferation, including TOP2A, are associated with aggressive prostate cancer. PMID: 18347174
  28. SSTR-1 overexpression effects on cell proliferation, cell cycle, and tumor growth in a mouse model are investigated. PMID: 18823376
  29. Immunohistochemistry shows SSTR1 expression in prostate tissue from patients with bladder outlet obstruction. PMID: 18936524
  30. Studies reveal crosstalk/interactions between SSTRs and ErbBs. PMID: 19070659
  31. SSTR1 and SSTR2 mRNA levels are higher in silent corticotroph adenoma and SCA compared to Cushing disease. PMID: 19318729
Database Links

HGNC: 11330

OMIM: 182451

KEGG: hsa:6751

STRING: 9606.ENSP00000267377

UniGene: Hs.248160

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Fetal kidney, fetal liver, and adult pancreas, brain, lung, jejunum and stomach.

Q&A

What is the structural composition of human SSTR1?

Human SSTR1 is a 391-amino acid G-protein-coupled receptor with seven transmembrane domains located at positions 57-84, 95-120, 132-153, 176-196, 220-244, 271-296, and 304-327 in the primary sequence. The receptor has a molecular weight of 42,685.77 Daltons and a theoretical isoelectric point (pI) of 8.4 . As with other GPCRs, SSTR1 features an extracellular N-terminus, seven membrane-spanning α-helical domains connected by alternating intracellular and extracellular loops, and an intracellular C-terminus. The receptor is primarily localized in the cell membrane and contains specific regions involved in ligand binding and G-protein interaction.

When designing experiments to study SSTR1 structure, researchers should consider using techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy. For recombinant expression, optimization of codon usage for the expression system of choice is critical, as is the inclusion of appropriate tags for purification that minimally interfere with receptor folding and function.

What are the primary signaling pathways associated with SSTR1?

SSTR1 primarily signals through pertussis toxin-sensitive G proteins (Gαi/o) to inhibit adenylyl cyclase, resulting in decreased intracellular cAMP levels. Additionally, SSTR1 stimulates phosphotyrosine phosphatase and Na+/H+ exchanger activity via pertussis toxin-insensitive G proteins . The receptor participates in the cellular response to leukemia inhibitory factor, G protein-coupled receptor signaling pathways coupled to cyclic nucleotide second messengers, and negative regulation of cell population proliferation .

For investigating these pathways, researchers should consider the following methodological approaches:

  • BRET/FRET assays to measure G-protein coupling

  • Measurement of cAMP levels using ELISA or reporter assays

  • Western blotting for phosphorylation states of downstream targets

  • Ca2+ flux assays to monitor signaling dynamics

  • Pertussis toxin pre-treatment to distinguish between Gαi/o-dependent and independent pathways

How can I optimize recombinant SSTR1 expression for structural studies?

For successful recombinant expression of SSTR1, consider the following methodological approach:

  • Expression system selection: Mammalian cell lines (HEK293 or CHO) typically yield properly folded receptor with appropriate post-translational modifications. For larger-scale production, insect cell systems (Sf9, Sf21) may be considered.

  • Construct design:

    • Include an N-terminal signal sequence

    • Consider fusion partners to improve expression (e.g., BRIL, T4 lysozyme)

    • Add affinity tags (His6, FLAG) for purification

    • Consider including a cleavable thermostabilizing domain

  • Optimization strategies:

    • Use codon-optimized sequences for your expression system

    • Employ inducible expression systems to minimize toxicity

    • Consider adding antagonists during expression to stabilize the receptor

    • Implement temperature shifts (reduce to 30°C post-induction)

  • Purification considerations:

    • Select detergents carefully (DDM, LMNG, GDN)

    • Use lipid nanodisc or SMALP approaches to maintain native-like environment

    • Include cholesterol in purification buffers

    • Consider ligand addition during purification to enhance stability

The full-length amino acid sequence should be considered when designing expression constructs, as provided in the primary literature .

What are the known natural ligands for SSTR1 and their relative affinities?

SSTR1 exhibits differential binding affinities for naturally occurring somatostatin peptides. Somatostatin-14 (a 14-amino acid peptide) shows higher binding affinity to SSTR1 compared to somatostatin-28 (a 28-amino acid peptide) . This selective binding profile influences the receptor's physiological responses in different tissues.

When designing ligand binding studies, researchers should consider the following methodological approaches:

  • Radioligand binding assays using [125I]-labeled somatostatin analogs

  • Competition binding assays to determine relative affinities of different ligands

  • BRET/FRET-based binding assays for real-time monitoring

  • Surface plasmon resonance for binding kinetics

  • Isothermal titration calorimetry for thermodynamic parameters

What methodologies are most effective for studying SSTR1-ligand interactions at the molecular level?

For comprehensive analysis of SSTR1-ligand interactions, a multi-faceted approach is recommended:

  • Computational methods:

    • Homology modeling based on related GPCR structures

    • Molecular dynamics simulations in lipid bilayer environments

    • Quantitative structure-activity relationship (QSAR) studies

    • Comparative molecular field analysis (CoMFA) and comparative molecular similarity index analysis (CoMSIA)

  • Experimental validation:

    • Site-directed mutagenesis of predicted binding pocket residues

    • Photoaffinity labeling with crosslinkable ligand analogs

    • Hydrogen-deuterium exchange mass spectrometry

    • Thermostabilized receptor crystallography with bound ligands

Research has shown that electronegative, less-bulky, and hydrophobic atom substitutions can substantially increase the biological activity of SSTR1 ligands . Molecular dynamics simulations reveal important conformational changes upon ligand binding, with specific residues consistently involved in binding interactions.

Key residues identified in binding interactions include Y1.39, T2.64, T5.43, and Q6.55, which form hydrogen bonds with various SSTR1 antagonists . This information can guide rational design of novel compounds with enhanced binding properties.

How do post-translational modifications affect SSTR1 function and trafficking?

SSTR1 undergoes several post-translational modifications that significantly impact its function, localization, and signaling properties. Understanding these modifications requires sophisticated experimental approaches:

  • Identification of modification sites:

    • Mass spectrometry-based proteomics

    • Site-directed mutagenesis of potential modification sites

    • Metabolic labeling with modification-specific precursors

  • Functional analysis methods:

    • Phospho-specific antibodies to track receptor phosphorylation

    • Deglycosylation assays (PNGase F, Endo H) to study N-glycosylation

    • Pulse-chase experiments to monitor receptor trafficking

    • FRAP (Fluorescence Recovery After Photobleaching) for membrane dynamics

  • Trafficking studies:

    • Live-cell confocal microscopy with fluorescently tagged receptors

    • Biotinylation assays for surface expression quantification

    • Dominant-negative Rab GTPase constructs to disrupt specific trafficking pathways

    • TIRF microscopy for near-membrane visualization

The combination of these approaches allows for comprehensive characterization of how specific modifications influence receptor function in different cellular contexts and under various stimulation conditions.

What are the current challenges in developing selective ligands for SSTR1 versus other SSTR subtypes?

Developing selective SSTR1 ligands presents several challenges due to the high sequence homology among the five SSTR subtypes. Current research suggests the following methodological approaches to overcome these challenges:

  • Structural considerations:

    • Focus on electronegative, less bulky, and hydrophobic substitutions which have been shown to increase SSTR1 ligand activity

    • Target non-conserved residues in the binding pocket to achieve subtype selectivity

    • Exploit differences in the extracellular loops for selective binding

  • Screening strategies:

    • High-throughput screening against all five SSTR subtypes simultaneously

    • Fragment-based drug discovery approaches

    • Molecular dynamics-guided virtual screening

    • Biased library design based on known subtype preferences

  • Validation methods:

    • Functional selectivity assays measuring different pathway activations

    • Cross-reactivity profiling against all SSTR subtypes

    • In vivo selectivity validation in knockout/knockin models

    • PET imaging with subtype-selective tracers

Current selective compounds include fluorene derivatives with modified arylpiperazine moieties (compounds 125-142) and compounds that form hydrogen bonds with specific SSTR1 residues like Y1.39 (compounds 127, 130, 141, and 142) or T2.64 (compounds 128, 135, 139, and 140) .

How can molecular dynamics simulations inform our understanding of SSTR1 conformational changes?

Molecular dynamics (MD) simulations provide critical insights into SSTR1 dynamics that are difficult to capture experimentally. A systematic approach to MD studies should include:

  • System preparation:

    • Embed SSTR1 models in lipid-lipid bilayer membranes that mimic physiological conditions

    • Include appropriate membrane composition (cholesterol, phospholipids)

    • Properly solvate the system with explicit water molecules and physiological ion concentrations

  • Simulation protocols:

    • Multi-microsecond simulations to capture relevant conformational changes

    • Enhanced sampling techniques (metadynamics, umbrella sampling)

    • Replicate simulations with different starting conditions

    • Ligand-bound and apo-state comparative simulations

  • Analysis methods:

    • Tracking of distance changes between key structural elements

    • Identification of stable hydrogen bond networks

    • Principal Component Analysis to identify major motions

    • Markov State Modeling to identify metastable states

    • Energy landscape analysis for conformational energetics

MD trajectory analysis can reveal:

  • Crucial residues involved in SSTR1-ligand binding

  • Conformational changes in the protein after ligand binding

  • Probable ligand-binding sites and validation of these sites

  • Favorable conditions for forming stable, low-energy bioactive conformations of ligands inside binding sites

These insights can directly inform experimental design for mutation studies, guide drug discovery efforts, and help explain functional data from physiological experiments.

What are the optimal conditions for expression and purification of functional recombinant SSTR1 for structural biology studies?

For structural biology applications requiring high-purity, functional SSTR1, the following optimized protocol is recommended:

  • Expression system optimization:

ParameterRecommended ConditionsRationale
Host systemInsect cells (Sf9)Better for GPCR overexpression
Expression vectorBaculovirus with polyhedrin promoterHigh expression levels
Fusion partnersT4 lysozyme (ICL3) or BRIL (N-terminus)Improves crystallizability
TagsN-terminal His10-MBP with TEV cleavage siteEnhances expression and purification
Temperature27°C for 48-72 hours post-infectionAllows proper folding
Supplements10 μM antagonist ligandStabilizes receptor
  • Membrane preparation and solubilization:

    • Harvest cells and disrupt by nitrogen cavitation or sonication

    • Membrane fraction isolation through ultracentrifugation

    • Solubilize with 1% lauryl maltose neopentyl glycol (LMNG) with 0.1% cholesteryl hemisuccinate (CHS)

    • Include 100 mM NaCl, 20 mM HEPES pH 7.5, 10% glycerol, and protease inhibitors

  • Purification strategy:

    • IMAC using Ni-NTA resin (gradient elution with imidazole)

    • TEV protease treatment to remove fusion partners

    • Reverse IMAC to remove cleaved tags

    • Size exclusion chromatography using Superdex 200

    • Concentrate to 5-10 mg/ml for structural studies

  • Quality control assessments:

    • SDS-PAGE for purity (>95% homogeneity)

    • Western blot with SSTR1-specific antibodies

    • Radioligand binding assays to confirm functionality

    • Circular dichroism to verify secondary structure

    • Negative-stain EM for homogeneity verification

This systematic approach maximizes the likelihood of obtaining homogeneous, functionally active receptor suitable for crystallization trials, cryo-EM studies, or NMR spectroscopy.

How can SSTR1-targeted approaches be utilized in cancer research models?

SSTR1 expression in various tumors provides opportunities for both diagnostic and therapeutic applications in cancer research. The following methodological approaches are recommended:

  • Expression profiling in tumor models:

    • Quantitative RT-PCR for mRNA expression levels

    • Immunohistochemistry with validated antibodies

    • Western blotting of tumor lysates

    • Single-cell RNA sequencing for heterogeneity assessment

    • Correlation with clinical outcomes in patient-derived xenografts

  • Functional significance studies:

    • CRISPR/Cas9 knockout or knockdown approaches

    • Overexpression models using lentiviral vectors

    • Selective agonist/antagonist treatment to assess proliferation

    • Invasion/migration assays following receptor modulation

    • Combination studies with standard chemotherapeutics

  • Imaging applications:

    • Radiolabeled SSTR1-selective ligands for PET/SPECT imaging

    • Fluorescently labeled antibodies or ligands for intraoperative imaging

    • Multimodal imaging using nanoparticle-conjugated SSTR1 ligands

The development of SSTR1-selective imaging agents like Edotreotide gallium Ga-68 provides tools for researchers to track receptor expression in vivo . Additional therapeutic approaches may leverage compounds like Lutetium Lu 177 dotatate, which acts as an agonist on SSTR1 , enabling targeted radiation delivery to SSTR1-expressing cells.

What is the significance of SSTR1 polymorphisms in clinical research settings?

SSTR1 genetic variations can significantly impact receptor function, ligand binding, and downstream signaling, with important implications for personalized medicine approaches. To study these variations:

  • Identification methods:

    • Targeted sequencing of the SSTR1 gene (located on chromosome 14, locus 14q21.1)

    • Whole exome sequencing with focus on SSTR1 locus

    • SNP array analysis for common variants

    • Digital PCR for rare variant detection

  • Functional characterization approaches:

    • Site-directed mutagenesis to recreate polymorphisms

    • Stable cell lines expressing variant receptors

    • Ligand binding assays comparing wild-type and variant receptors

    • Signaling cascade activation measurements

    • Trafficking and internalization studies

  • Clinical correlation strategies:

    • Case-control association studies

    • Pharmacogenomic analyses in clinical trial populations

    • Biobanking initiatives with genotype-phenotype correlations

    • Meta-analyses of published variant data

When designing such studies, researchers should consider the potential functional consequences of variants in different domains of SSTR1, particularly those affecting the seven transmembrane regions (positions 57-84, 95-120, 132-153, 176-196, 220-244, 271-296, 304-327) which may directly impact ligand binding or receptor activation.

What methodologies are most effective for studying SSTR1 heterodimer formation with other GPCRs?

SSTR1, like many GPCRs, can form functional heterodimers with other receptors, altering signaling properties and pharmacological responses. To investigate these interactions:

  • Detection methods:

    • Bioluminescence resonance energy transfer (BRET)

    • Fluorescence resonance energy transfer (FRET)

    • Proximity ligation assay (PLA) in fixed cells or tissues

    • Co-immunoprecipitation with subtype-specific antibodies

    • Bi-molecular fluorescence complementation (BiFC)

  • Functional analysis approaches:

    • Ligand binding studies in co-expression systems

    • Signaling assays comparing monomers vs. heterodimers

    • Trafficking studies using dual-color microscopy

    • Electrophysiological recordings in heterologous expression systems

    • Calcium imaging with receptor-specific triggers

  • Methodological controls:

    • Expression level normalization across experimental conditions

    • Negative controls using non-interacting receptor pairs

    • Disruption of dimerization through interface mutations

    • Computational predictions of interaction interfaces

    • Concentration-dependent studies to distinguish specific vs. random interactions

The integration of these complementary approaches provides robust evidence for physiologically relevant heterodimer formation and its functional consequences, which may guide the development of heterodimer-selective therapeutic agents.

How can single-molecule techniques advance our understanding of SSTR1 dynamics?

Single-molecule approaches offer unprecedented insights into SSTR1 behavior that are masked in ensemble measurements. To implement these techniques:

  • Single-molecule fluorescence methods:

    • Single-molecule FRET to track conformational changes

    • Total internal reflection fluorescence (TIRF) microscopy for membrane dynamics

    • Fluorescence correlation spectroscopy (FCS) for diffusion properties

    • Single-particle tracking for receptor mobility analysis

    • Super-resolution techniques (PALM/STORM) for nanoscale organization

  • Force-based techniques:

    • Atomic force microscopy for topological mapping

    • Optical tweezers for measuring interaction forces

    • Magnetic tweezers for conformational manipulation

    • Single-molecule force spectroscopy for unfolding dynamics

  • Experimental design considerations:

    • Site-specific labeling strategies (SNAP-tag, HaloTag, unnatural amino acids)

    • Minimally invasive fluorophore selection

    • Surface passivation to prevent non-specific interactions

    • Temperature and buffer optimization for physiological relevance

    • Correlation with functional assays for biological context

These approaches can reveal transient conformational states, rare events in receptor activation, and kinetic heterogeneity that might explain variable responses to the same ligand under seemingly identical conditions.

What role does SSTR1 play in neuroendocrine signaling networks and how can this be studied?

SSTR1's involvement in neuroendocrine signaling requires integrated experimental approaches across multiple scales:

  • Cellular localization studies:

    • Multi-color immunofluorescence with cell type-specific markers

    • In situ hybridization for mRNA localization

    • Electron microscopy for subcellular localization

    • CLARITY or iDISCO+ techniques for 3D tissue mapping

    • Single-cell transcriptomics to identify SSTR1-expressing populations

  • Functional circuit mapping:

    • Optogenetic manipulation of SSTR1-expressing neurons

    • Chemogenetic approaches using DREADDs

    • Electrophysiological recordings in brain slices

    • Calcium imaging during stimulation protocols

    • In vivo microdialysis for neurotransmitter measurements

  • Systems-level analysis:

    • Conditional knockout models (Cre-loxP) for tissue-specific deletion

    • Physiological readouts (hormone levels, glucose homeostasis)

    • Behavioral assays relevant to neuroendocrine function

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Computational modeling of network interactions

These approaches can illuminate SSTR1's role in complex processes like the cellular response to leukemia inhibitory factor and negative regulation of cell population proliferation , providing insights into both normal physiology and pathological states.

How can computational approaches guide the development of biased ligands for SSTR1?

Biased ligands preferentially activate specific signaling pathways downstream of SSTR1, offering potential therapeutic advantages. To develop such compounds:

  • Computational screening approaches:

    • Structure-based virtual screening targeting specific receptor conformations

    • Molecular dynamics simulations to identify state-specific binding pockets

    • Machine learning models trained on pathway-selective compounds

    • Quantitative structure-activity relationship (QSAR) models incorporating bias metrics

    • Network pharmacology to predict pathway-selective effects

  • In silico design principles:

    • Focus on electronegative, less-bulky, and hydrophobic atom substitutions proven to enhance SSTR1 activity

    • Target specific residues like Y1.39, T2.64, T5.43, and Q6.55 that form hydrogen bonds with various SSTR1 ligands

    • Exploit differences in binding site conformations between active and inactive states

    • Design compounds that stabilize specific transmembrane helical arrangements

    • Incorporate molecular interactions that favor coupling to specific G proteins or arrestins

  • Validation pipeline:

    • BRET-based assays for pathway-specific activation

    • Phosphoproteomic analysis of signaling cascades

    • Label-free cellular assays (impedance, DMR)

    • Conformational biosensors to detect receptor states

    • In vivo validation in disease models

The integration of computational prediction with robust experimental validation facilitates the development of SSTR1 ligands with tailored signaling profiles, potentially improving therapeutic outcomes while minimizing adverse effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.