Recombinant Human Somatostatin receptor type 4 (SSTR4)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

SSTR4 mediates diverse signaling pathways:

  • Inhibition of cAMP: Via Gαi/o coupling, reducing adenylyl cyclase activity .

  • MAP Kinase Activation: Promotes anti-proliferative effects in tumor cells .

  • Arachidonate Release: Linked to anti-inflammatory responses .

  • Synergy with δ-Opioid Receptors: Forms heterodimers to enhance pain relief and reduce opioid withdrawal symptoms .

Clinical Trial Targets

DrugPhaseIndicationMechanism
LY3556050Phase 2Chronic low-back painSSTR4 agonist
CNTX-0290Phase 1Chronic painSSTR4 agonist
177Lu-DOTATATEPhase 2Hepatitis C virus infectionRadioligand therapy

Preclinical Findings

  • Analgesia: SSTR4 agonists (e.g., J-2156) show efficacy in neuropathic and inflammatory pain models without endocrine side effects .

  • Neuropsychiatric Effects: Mediates antidepressant and anxiolytic actions in rodent studies .

  • Cancer: Inhibits proliferation in SSTR4-expressing tumors via MAPK suppression .

Tissue Expression and Localization

SSTR4 is predominantly expressed in:

  • Central Nervous System: Cortical pyramidal neurons, hippocampal CA1/CA2 regions, and amygdala (glutamatergic neurons) .

  • Peripheral Tissues: Lung, gastrointestinal intramural ganglia, and pancreatic acinar cells .

  • Absence: Anterior pituitary, pancreatic β-cells .

Research Tools and Reagents

  • Antibodies: Clone sstr4 (Bio-Rad) shows exclusive specificity for human SSTR4 .

  • Transgenic Models: hSSTR4 knock-in mice enable translational studies of human receptor biology .

  • Ligands: Synthetic agonists (J-2156, L-803,087) and antagonists (CYN 154806) facilitate mechanistic studies .

Challenges and Future Directions

While SSTR4’s lack of endocrine effects makes it a promising target, challenges include:

  • Species-specific ligand affinity differences requiring humanized models .

  • Limited subtype selectivity of current agonists .

  • Need for brain-penetrant drugs to target CNS disorders .

Structural insights from cryo-EM (e.g., Gi1 coupling in SST-14-bound states) are guiding rational drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SSTR4; Somatostatin receptor type 4; SS-4-R; SS4-R; SS4R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SSTR4
Target Protein Sequence
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM CPPLPCQQEALQPEPGRKRIPLTRTTTF
Uniprot No.

Target Background

Function
Somatostatin receptor type 4 (SSTR4) serves as a receptor for somatostatin-14. Its activity is mediated by G proteins, leading to the inhibition of adenylyl cyclase. This receptor is functionally coupled not only to the inhibition of adenylate cyclase but also to the activation of both arachidonate release and the mitogen-activated protein (MAP) kinase cascade. SSTR4 plays a crucial role in mediating the antiproliferative effects of somatostatin in tumor cells.
Gene References Into Functions
  1. Studies on Alzheimer's disease cortices have shown that deregulated somatostatin signaling cannot be attributed to hypermethylation of the SST or SSTR4 promoter CpG islands. PMID: 24602981
  2. Research has demonstrated that CD26 is associated with SSTR4 in malignant pleural mesothelioma cells, and this interaction inhibits SSTR4-mediated cytostatic effects. PMID: 24743707
  3. High SSTR4 expression has been linked to lymph node metastasis in gallbladder cancer. PMID: 23991955
  4. Research has explored the potential use of sst5TMD4 expression in surgically removed pituitary adenomas as a predictor of the subsequent response of different pituitary tumors to somatostatin therapy. PMID: 20233783
  5. In somatotrophinomas patients treated with somatostatin analogs, the most expressed SSTRs were found to be SSTR5, SSTR3, SSTR2, SSTR1, and SSTR4, respectively. PMID: 19330452
  6. Expression of SSTR4 transcripts has been observed to be up-regulated in prostatic carcinoma cells, suggesting that SSTR4 agonists may play a role in the treatment of prostate cancer. PMID: 12210479
  7. Immunohistochemical studies of SSTR4 in laryngeal benign, premalignant, and malignant specimens revealed a variable degree of expression, with the highest percentage observed in malignant specimens. PMID: 18066572
  8. An immunohistochemical study of SSTR4 in prostate tissue from patients with bladder outlet obstruction indicated that close to 90% of secretory cells exhibited weak positivity in the cytoplasm. PMID: 18936524
  9. Heterodimerization between somatostatin receptor 4 (SSTR4) and somatostatin receptor 5 (SSTR5) has been shown to induce receptor and ligand-specific changes in receptor coupling to adenylyl cyclase and the downstream signaling pathway. PMID: 19426801
  10. Research has investigated the expression, localization, and inflammation-induced alterations of SSTR4 receptors in murine and human lungs. PMID: 19687471

Show More

Hide All

Database Links

HGNC: 11333

OMIM: 182454

KEGG: hsa:6754

STRING: 9606.ENSP00000255008

UniGene: Hs.673846

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in fetal and adult brain, lung tissue, stomach, and in lesser quantities in the kidney, pituitary and adrenals.

Q&A

What is human Somatostatin receptor type 4 and how was it discovered?

Somatostatin receptor type 4 (SSTR4) belongs to the somatostatin receptor family, which consists of five G-protein-coupled receptors (designated SST₁-SST₅) that mediate the actions of somatostatin. SSTR4 was cloned and characterized as the fourth human somatostatin receptor in the early 1990s . This receptor is specifically expressed in both human fetal and adult brain and lung tissue, with a distinct tissue distribution and pharmacological properties different from other known somatostatin receptors . Unlike other somatostatin receptors, SSTR4 activation produces analgesic, anti-inflammatory, anti-amyloid, anti-anxiety, and antidepressant effects without influencing hormone secretion .

Where is SSTR4 primarily expressed in human tissues?

Human SSTR4 shows predominant expression in the brain, though it is also present in various peripheral tissues. Within the brain, highest expression levels are detected in specific regions:

  • Highest expression: CA2 field of the hippocampus and piriform cortex

  • Moderate expression: Primary somatosensory cortex (particularly layers II and III)

  • Lower but considerable expression: Granular layer of the olfactory bulb, prelimbic cortex, basolateral nucleus of the amygdala, and basomedial nucleus of the amygdala

Outside the central nervous system, SSTR4 expression has been documented in the lungs, thymus, pituitary gland, and placenta . Notably, SSTR4 has been shown to be the predominant somatostatin receptor in the human placenta, suggesting a potential role in embryonal growth regulation .

How does SSTR4 differ from other somatostatin receptor subtypes?

SSTR4 possesses unique characteristics that distinguish it from other somatostatin receptor subtypes:

  • Physiological effects: SSTR4 mediates analgesic, anti-inflammatory, and antidepressant effects without the endocrine actions typically associated with other somatostatin receptors

  • Pharmacological profile: SSTR4 exhibits distinct binding properties for somatostatin analogs compared to other receptor subtypes

  • Neuronal localization: In brain regions like the hippocampus (CA1 and CA2), SSTR4 is predominantly localized on glutamatergic excitatory neurons, while in the granular layer of the olfactory bulb, it is expressed in GABAergic interneurons

  • Stress response: SSTR4 expression fluctuates in response to stress, with different dynamics in various organs following single or chronic stress exposure

What techniques are most effective for detecting SSTR4 in experimental settings?

Several complementary techniques can be employed for effective detection of SSTR4 in research settings:

mRNA Detection:

  • RT-qPCR: For quantitative measurement of SSTR4 mRNA expression levels in tissue samples

  • RNAscope in situ hybridization: Provides cellular resolution of SSTR4 transcript distribution in tissue sections, allowing for co-localization studies with neuronal markers

Protein Detection:

  • Western blotting: For semi-quantitative measurement of SSTR4 protein expression using specific antibodies

  • ELISA: Allows quantitative measurement of SSTR4 protein levels

Functional Assays:

  • Electrophysiological recordings: For characterizing the effects of SSTR4 activation on neuronal activity

  • Behavioral assays: To assess SSTR4-mediated analgesic and antidepressant effects in animal models

How can researchers generate and utilize humanized SSTR4 mouse models?

Generation of humanized SSTR4 mouse models involves several sophisticated genetic engineering approaches:

Transposon-Based Random Insertion Approach:

  • Create a transposon vector containing the hSSTR4 gene and reporter gene construct driven by human SSTR4 regulatory elements

  • Randomly insert the vector in Sstr4-deficient mice to avoid the influence of mouse regulatory elements

  • Use insulator regions to flank the intact human regulatory elements to better resemble the human receptor expression pattern

Advantages of Random Insertion vs. Knock-in:

  • Avoids the influence of mouse regulatory elements on the transgene

  • Allows the human regulatory elements to control expression

  • Better mimics human receptor expression patterns

Validation and Characterization:

  • Bioluminescent in vivo imaging of luciferase reporter to detect hSSTR4 expression

  • RT-qPCR to confirm expression in brain and peripheral tissues

  • RNAscope in situ hybridization to map cellular expression patterns

Applications of Humanized SSTR4 Mouse Models:

  • Investigate differences between human and mouse SSTR4 receptor expression and function

  • Assess the effects of SSTR4 receptor agonist drug candidates more predictive of human responses

  • Provide a translational animal model for preclinical research relevant to human diseases

What methodologies are used to study SSTR4 expression patterns in the brain?

Researchers employ several complementary approaches to characterize SSTR4 expression patterns in the brain:

RNAscope In Situ Hybridization:
This technique allows for the visualization of SSTR4 mRNA transcripts at the cellular level and can be combined with markers for specific neuronal populations. Studies have revealed:

  • hSSTR4 is predominantly localized on glutamatergic excitatory neurons (Vglut1+) in the primary somatosensory cortex, piriform cortex, prelimbic cortex, and amygdala

  • In the hippocampus, CA1 and CA2 regions show hSSTR4 localization in glutamatergic excitatory neurons

  • In the granular layer of the olfactory bulb, hSSTR4 transcripts are detected in GABAergic interneurons (Gad1+)

Reporter Gene Systems:

  • Luciferase reporters allow for in vivo bioluminescent imaging of SSTR4 expression patterns

  • Fluorescent protein reporters (e.g., tdTomato) can be used, though sensitivity limitations may require enhancement techniques

Quantitative RT-PCR:
RT-qPCR can be used to quantify SSTR4 mRNA expression levels across different brain regions and compare expression under various physiological or pathological conditions .

Comparative Analysis:
Studies comparing the expression of SSTR4 under different conditions (e.g., stress vs. control) provide insights into the regulation of receptor expression. For example, research has shown that Sstr4 mRNA expression decreases significantly in the pituitary gland following both chronic and single stress, but increases in the thymus following chronic stress .

How can SSTR4 be targeted for therapeutic development in pain and depression?

SSTR4 represents a promising novel drug target for chronic pain and depression, particularly because its activation does not influence hormone secretion, potentially limiting side effects. Several approaches for therapeutic development include:

Development of Selective SSTR4 Agonists:

  • Non-peptide SST4 agonists are being developed by pharmaceutical companies

  • The synthetic SST4 receptor agonist J-2156 has shown efficacy in preclinical models of pain and depression

  • In silico 3D modeling of the human receptor structure has enhanced agonist design

Experimental Evidence Supporting SSTR4 as a Therapeutic Target:

  • Studies using Sstr4 knockout (KO) and wild-type mice have provided evidence that SST4 receptor is a novel drug target for chronic pain and depression

  • The currently available drugs for these conditions often lack efficacy and cause serious side effects upon long-term use, highlighting the need for new therapeutic approaches

Translational Research Approaches:

  • Humanized SSTR4 mouse models provide more predictive platforms for testing drug candidates relevant to human diseases

  • These models help overcome species differences in SSTR4 receptor expression and function between humans and mice

What is the relationship between SSTR4 expression and stress responses?

Research has revealed complex dynamics in SSTR4 expression in response to stress:

Tissue-Specific Expression Changes:

  • Pituitary gland: Sstr4 mRNA expression decreases significantly in both chronic and single stress conditions (P = 0.0181 and 0.0022, respectively)

  • Lungs: Sstr4 mRNA expression decreases significantly in single stress conditions (P = 0.0124)

  • Thymus: Sstr4 mRNA expression increases significantly in chronic stress conditions (P = 0.0313)

Potential as a Stress Biomarker:

  • The differential expression patterns of SSTR4 in various organs following single or chronic stress suggest its potential utility as a stress marker

  • Investigating SSTR4 expression across multiple organs could allow estimation of stress-loading periods and aid in diagnosing chronic stress

Relevance to Mental Health:

  • Chronic stress has been implicated in mental illnesses and depressive behaviors

  • SSTR4 has been shown to mediate anxiolytic and depression-like effects

  • The stress-induced changes in SSTR4 expression may contribute to understanding the mechanisms linking chronic stress to depression

How does neuronal expression of SSTR4 relate to its analgesic and antidepressant effects?

The neuroanatomical distribution of SSTR4 provides insights into its role in pain processing and mood regulation:

Expression in Pain-Related Regions:

  • SSTR4 is expressed in the primary somatosensory cortex (S1), which processes sensory information including pain

  • Its presence in glutamatergic neurons in these regions suggests modulation of excitatory neurotransmission

Expression in Mood-Regulating Regions:

  • SSTR4 is expressed in brain regions implicated in mood regulation, including the prelimbic cortex, amygdala, and hippocampus

  • The basolateral and basomedial nuclei of the amygdala, which express SSTR4, are involved in emotional processing and fear responses

Neuronal Subtypes:

  • In most brain regions, SSTR4 is predominantly expressed in glutamatergic excitatory neurons, suggesting it modulates excitatory neurotransmission

  • In specific regions like the granular layer of the olfactory bulb, SSTR4 is expressed in GABAergic interneurons, indicating potential regulation of inhibitory circuits

Functional Implications:

  • SSTR4 activation likely modulates neuronal activity in pain and mood circuits

  • The receptor's presence in specific neuronal populations explains how selective SSTR4 agonists can produce analgesic and antidepressant effects without affecting endocrine functions

What are the challenges in developing specific antibodies for SSTR4 detection?

Developing reliable antibodies for SSTR4 detection has been challenging for several reasons:

Limited Specificity:

  • Research has noted that "there is no reliably specific anti-SST₄ antibody on the market"

  • Cross-reactivity with other somatostatin receptor subtypes is a common issue due to structural similarities

Technical Considerations for SSTR4 Antibody Production:

  • SSTR4 is a G-protein-coupled receptor with seven transmembrane domains, making it difficult to produce as an immunogen

  • The extracellular domains that could serve as antibody epitopes are relatively small

  • Post-translational modifications can affect antibody recognition

Alternative Approaches:

  • RNA-based detection methods (RT-qPCR, RNAscope) have been more reliable for SSTR4 localization studies

  • Reporter gene systems in transgenic animals provide an alternative for tracking SSTR4 expression

  • Commercial antibodies are available but require careful validation for specific applications

How do species differences affect SSTR4 research and drug development?

Species differences in SSTR4 represent a significant consideration in translational research:

Expression Pattern Differences:

  • Human and mouse SSTR4 show different expression patterns across tissues

  • These differences can affect the interpretation of results from animal models

Functional Variations:

  • Species-specific variations in receptor pharmacology may lead to different responses to the same compounds

  • Drug candidates that work in mouse models may not translate effectively to humans due to these differences

Addressing Species Differences:

  • Humanized mouse models have been developed to overcome species differences in SSTR4 receptor expression and function

  • These models contain the human SSTR4 gene with its regulatory elements, providing a more translational platform for drug testing

  • As noted in research: "To overcome the species differences of SST₄ receptor expression and function between humans and mice, we generated an SST₄ humanized mouse line to serve as a translational animal model for preclinical research"

What are the latest developments in SSTR4-targeted therapeutics?

Recent advances in SSTR4-targeted therapeutics include:

Novel Agonist Development:

  • Pharmaceutical companies have begun developing non-peptide SSTR4 agonists

  • The design of these agonists has been enhanced by in silico 3D modeling of the human receptor structure

  • The synthetic SSTR4 receptor agonist J-2156 has shown promising results in preclinical models

Therapeutic Applications Beyond Pain and Depression:

  • Anti-inflammatory effects: SSTR4 activation has shown anti-inflammatory properties, expanding potential therapeutic applications

  • Anti-amyloid effects: Suggesting potential applications in neurodegenerative diseases

  • Anti-anxiety effects: Indicating broader applications in anxiety disorders

Translational Research Advancements:

  • Humanized SSTR4 mouse models provide more predictive platforms for testing drug candidates

  • These models help bridge the gap between preclinical research and human applications

  • They enable more accurate assessment of SSTR4 agonist drug candidates for human conditions

What are the optimal experimental conditions for studying recombinant SSTR4?

When working with recombinant SSTR4, researchers should consider these experimental parameters:

Expression Systems:

  • Mammalian cell lines (HEK293, CHO) typically provide proper post-translational modifications

  • Cell lines with low endogenous somatostatin receptor expression should be selected to avoid interference

Detection Methods:

  • For protein analysis: Western blotting and ELISA with validated antibodies

  • For gene expression: RT-qPCR with specific primers spanning exon-exon junctions

  • For localization: RNAscope in situ hybridization has proven effective for cellular resolution

Functional Assays:

  • Ligand binding assays to assess receptor-ligand interactions

  • G-protein activation assays (e.g., GTPγS binding)

  • Downstream signaling measurements (cAMP, Ca²⁺ mobilization)

  • Electrophysiological recordings to assess neuronal impacts

Storage and Handling:
For antibodies: "Store at -20°C for one year. For short-term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles"

How can co-expression studies enhance our understanding of SSTR4 function?

Co-expression studies provide valuable insights into SSTR4's cellular context and functional interactions:

Neuronal Subtype Characterization:

  • RNAscope in situ hybridization allows for co-localization studies with neuronal markers

  • Such studies have revealed that hSSTR4 is predominantly localized on glutamatergic excitatory neurons (Vglut1+) in many brain regions, while being present in GABAergic interneurons (Gad1+) in specific areas like the granular layer of the olfactory bulb

Receptor Heterodimerization:

  • SSTR4 may form heterodimers with other G-protein-coupled receptors, altering signaling properties

  • Co-immunoprecipitation and bioluminescence/fluorescence resonance energy transfer (BRET/FRET) techniques can investigate these interactions

Signaling Pathway Integration:

  • Co-expression with various downstream signaling components helps map the complete signaling cascades

  • This approach can identify cell type-specific signaling mechanisms of SSTR4

Methodological Considerations:

  • Multiple labeling approaches combining SSTR4 detection with other cellular markers

  • Conditional expression systems to study SSTR4 function in specific cell populations

  • Single-cell transcriptomics to identify co-expression patterns at high resolution

How might SSTR4 research contribute to precision medicine approaches?

SSTR4 research holds potential for advancing precision medicine in several ways:

Biomarker Development:

  • SSTR4 expression dynamics in response to stress could serve as biomarkers for stress-related disorders

  • Measuring SSTR4 expression across multiple organs might help estimate stress-loading periods and aid in diagnosing chronic stress

Patient Stratification:

  • Variations in SSTR4 expression or function might identify patient subgroups most likely to respond to targeted therapies

  • Genetic polymorphisms in SSTR4 could predict treatment responses to SSTR4-targeted drugs

Personalized Treatment Approaches:

  • Development of selective SSTR4 agonists could provide therapeutic options with fewer side effects for patients with chronic pain or depression

  • Combination therapies targeting SSTR4 along with other mechanisms could be tailored to individual patient profiles

Technological Innovations:

  • Advanced imaging of SSTR4 expression could guide personalized treatment decisions

  • Integration of SSTR4 biomarkers with other clinical data could improve diagnostic accuracy and treatment selection

What interdisciplinary approaches might advance SSTR4 research?

Advancing SSTR4 research will benefit from integrating multiple scientific disciplines:

Computational Biology and Structural Modeling:

  • In silico 3D modeling of human SSTR4 has already enhanced agonist design

  • Molecular dynamics simulations can predict ligand-receptor interactions

  • Machine learning approaches might identify novel SSTR4 modulators

Neuroscience and Behavioral Research:

  • Advanced circuit mapping techniques to understand how SSTR4-expressing neurons integrate into brain networks

  • Optogenetic and chemogenetic approaches to selectively manipulate SSTR4-expressing neurons

  • Sophisticated behavioral paradigms to better assess pain, depression, and anxiety phenotypes

Translational Research:

  • Humanized mouse models provide platforms for testing drug candidates with greater relevance to human disease

  • Patient-derived induced pluripotent stem cells (iPSCs) differentiated into neurons could provide human cellular models

  • Clinical research correlating SSTR4 expression with disease states and treatment responses

Multi-omics Integration:

  • Combining transcriptomics, proteomics, and metabolomics to understand SSTR4 regulation

  • Single-cell analysis to identify specific cell populations expressing SSTR4

  • Systems biology approaches to model SSTR4 signaling networks in health and disease

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.