Recombinant Human Somatostatin receptor type 5 (SSTR5)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Somatostatin receptor type 5 (SSTR5) belongs to the G protein-coupled receptor (GPCR) superfamily and represents one of five distinct somatostatin receptor subtypes (SSTR1-5) identified in humans. These receptors mediate the biological effects of the inhibitory peptide hormones somatostatin-14 (SST-14) and somatostatin-28 (SST-28), which regulate numerous physiological processes including hormone secretion, cell proliferation, and neurotransmission. SSTR5 features the characteristic seven-transmembrane domain structure typical of class A GPCRs and exhibits a distinctive pharmacological profile that distinguishes it from other somatostatin receptor subtypes, particularly its preferential binding to SST-28 over SST-14 .

Genetic and Protein Structure

The human SSTR5 gene encodes a protein of 363 amino acids with a DNA sequence identical to the coding sequence documented in GenBank (accession number D16827.1), and the corresponding protein sequence matches GenBank entry NP_001044.1 . As a typical GPCR, SSTR5 features seven transmembrane helical domains connected by three extracellular loops (ECLs) and three intracellular loops (ICLs). The N-terminal domain resides extracellularly, while the C-terminus extends into the cytoplasm, facilitating coupling with intracellular signaling molecules and regulatory proteins.

Three-Dimensional Structure and Ligand Binding

Recent advances in cryogenic electron microscopy (cryo-EM) have provided high-resolution structural insights into SSTR5. Two cryo-EM structures of SSTR5-G protein complexes have been determined at resolutions of 2.7 Å and 2.9 Å, bound to the cyclic neuropeptide agonist cortistatin-17 (CST17) and the synthetic agonist octreotide, respectively . These structures have revealed the detailed molecular architecture of SSTR5 in its activated state, showing the receptor's interaction with both ligands and G proteins.

The orthosteric binding pocket of SSTR5 is formed by the extracellular regions of the transmembrane helices and extracellular loops, excluding TM1 . This binding pocket accommodates peptide ligands such as CST17 and octreotide, which adopt circular β-hairpin structures stabilized by intramolecular disulfide bonds. A key feature of ligand recognition is the interaction with the conserved FWKT motif present in both natural somatostatin peptides and synthetic analogs like octreotide. This motif inserts into the central pocket, establishing crucial interactions with the receptor .

Cell Lines and Expression Methods

Recombinant human SSTR5 has been successfully expressed in various cell systems for structural and functional studies. The most commonly used expression system is the Chinese hamster ovary (CHO-K1) cell line, which provides a reliable platform for stable expression of functional human SSTR5 . For stable expression, bicistronic expression plasmids containing the sequence coding for human SSTR5 are typically transfected into CHO-K1 cells. Geneticin-resistant clones are obtained by limit dilution and compared for receptor expression levels using radioligand binding assays .

Receptor Expression Characteristics

In stably transfected CHO-K1 cells, SSTR5 expression levels (Bmax) have been estimated to be 7-10 pmol/mg protein, as determined using [125I]-[Tyr11]-SRIF-14 as the radioligand . The dissociation constant (Kd) for this radioligand is approximately 1.9 nM . These expression systems have enabled detailed pharmacological characterization of the receptor and development of screening platforms for identifying novel ligands.

Table 1: Characteristics of Recombinant Human SSTR5 Expression Systems

ParameterValueSystemReference
Expression Level (Bmax)7-10 pmol/mg proteinCHO-K1 cells
Radioligand Kd ([125I]-[Tyr11]-SRIF-14)1.9 nMCHO-K1 cells
Cell Line DevelopmentBicistronic expression plasmid with geneticin selectionCHO-K1 cells
DNA SequenceIdentical to GenBank D16827.1-
Protein SequenceIdentical to GenBank NP_001044.1-

Natural and Synthetic Agonists

The natural agonists of SSTR5 are the endogenous peptide hormones somatostatin-14 (SST-14) and somatostatin-28 (SST-28). A distinctive feature of SSTR5 is its preferential binding of SST-28 over SST-14, which contrasts with other somatostatin receptor subtypes (SSTR1-4) that exhibit higher affinity for SST-14 . Binding studies with recombinant human SSTR5 expressed in CHO-K1 cells have demonstrated high-affinity binding of both SST-14 and SST-28, with IC50 values of 1.1-2.1 nM for SST-14 and 0.25-5.4 nM for SST-28 .

Various synthetic peptide analogs of somatostatin have been developed as agonists or antagonists for different somatostatin receptor subtypes. Octreotide, a stable somatostatin analog that retains the FWKT core pharmacophore, binds to both SSTR2 and SSTR5, albeit with different affinities for the two receptors . Other synthetic compounds characterized for their interaction with SSTR5 include L-362,855, which acts as a partial agonist, and BIM-23056, which functions as a specific antagonist .

Binding Affinities and Selectivity Profiles

The binding affinities and selectivity profiles of various ligands for recombinant human SSTR5 are summarized in Table 2:

Table 2: Binding Affinities of Various Ligands for Recombinant Human SSTR5

LigandBinding AffinityTypeCommentReference
SST-14IC50: 1.1-2.1 nMNatural agonistLower affinity than SST-28
SST-28IC50: 0.25-5.4 nMNatural agonistHigher affinity than SST-14
Octreotide-Synthetic agonistBinds to both SSTR2 and SSTR5
L-362,855pEC50: 7.2Partial agonist~30% of maximum SRIF response
BIM-23056pKB: 7.4AntagonistSpecific SSTR5 antagonist

G Protein Modulation of Binding

Radioligand binding to human SSTR5 is significantly inhibited by guanine nucleotides such as GTP and its non-hydrolyzable analog GTPγS, as well as by pertussis toxin treatment . This indicates that the binding affinity of agonists to SSTR5 is modulated by G protein coupling, a characteristic feature of GPCRs. The sensitivity to pertussis toxin suggests the involvement of Gi/Go proteins in receptor signaling.

G Protein Coupling

SSTR5 primarily couples to inhibitory G proteins (Gi/Go), through which it mediates many of its cellular effects. This coupling is evidenced by the sensitivity of SSTR5 signaling to pertussis toxin, which specifically inactivates Gi/Go proteins . The coupling to Gi proteins is consistent with the receptor's ability to inhibit adenylyl cyclase activity in response to agonist stimulation.

Interestingly, there is also evidence for coupling of SSTR5 to stimulatory G proteins (Gs) under certain conditions, as indicated by the article title "Activation of adenylate cyclase by human recombinant sst5 receptors expressed in CHO-K1 cells and involvement of Gαs proteins" . This dual coupling may contribute to cell type-specific responses to SSTR5 activation.

Adenylyl Cyclase Regulation

One of the primary signaling pathways mediated by SSTR5 is the regulation of adenylyl cyclase. In recombinant systems expressing human SSTR5, both SST-14 and SST-28 modulate cAMP production . This modulation appears to involve both inhibitory and stimulatory mechanisms, depending on the cellular context and experimental conditions.

Phosphoinositide Metabolism

Beyond adenylyl cyclase regulation, SSTR5 also mediates activation of phosphoinositide metabolism in a pertussis toxin-sensitive manner . This has been demonstrated in CHO-K1 cells expressing recombinant human SSTR5, where agonist stimulation leads to increased accumulation of inositol phosphates.

In this system, SST-14, SST-28, and the cyclic hexapeptide L-362,855 produce time- and concentration-dependent increases in [3H]-inositol phosphate accumulation, with similar potency (pEC50 values of 6.5, 6.8, and 7.2, respectively) . L-362,855 acts as a partial agonist, producing approximately 30% of the maximum response to SST-14. The peptide analogs BIM-23027 and BIM-23056 are inactive as agonists in this system, with BIM-23056 functioning as a specific antagonist .

Table 3: Functional Responses of Recombinant Human SSTR5

LigandPathwayEffectPotency (pEC50)EfficacyReference
SST-14Inositol phosphate accumulationIncrease6.5Full agonist
SST-28Inositol phosphate accumulationIncrease6.8Full agonist
L-362,855Inositol phosphate accumulationIncrease7.2Partial agonist (~30%)
BIM-23056Inositol phosphate accumulationAntagonismpKB: 7.4Antagonist

Agonist and Antagonist Profiles

The pharmacological profiles of various agonists and antagonists at recombinant human SSTR5 have been characterized in detail. As shown in Table 3, SST-14, SST-28, and L-362,855 act as agonists in functional assays measuring inositol phosphate accumulation, while BIM-23056 functions as a specific antagonist.

BIM-23056 potently antagonizes SST-14-induced inositol phosphate accumulation with a pKB value of 7.4 but does not block responses to unrelated stimuli such as UTP, confirming its specificity for SSTR5 . This antagonist provides a valuable tool for investigating SSTR5 function and may serve as a starting point for developing more selective SSTR5-targeted therapeutics.

Partial Agonism

L-362,855 exhibits partial agonism at recombinant human SSTR5, producing only about 30% of the maximum response to SST-14 in inositol phosphate accumulation assays . At increasing concentrations, L-362,855 not only increases inositol phosphate accumulation on its own but also produces rightward shifts of SST-14 concentration-effect curves, consistent with its action as a partial agonist .

The observation of partial agonism suggests the potential for biased signaling at SSTR5, where different ligands may preferentially activate certain signaling pathways over others. This concept of biased signaling or functional selectivity is increasingly recognized as important in GPCR pharmacology and may provide opportunities for developing more selective therapeutic agents with improved efficacy or reduced side effects.

Role in Neuroendocrine Disorders

SSTR5 represents an important therapeutic target for neuroendocrine tumors and pituitary disorders . Somatostatin receptor 5 is prominently expressed in various neuroendocrine tissues and tumors, making it a valuable target for both diagnostic imaging and therapeutic intervention. Somatostatin analogs that activate SSTR5 can inhibit hormone secretion from these tumors and potentially slow tumor growth, providing symptomatic relief and clinical benefit.

Development of Selective Ligands

Recent structural insights into SSTR5 activation and ligand binding provide a foundation for structure-based drug design targeting this receptor . The detailed molecular understanding of how different ligands interact with and activate SSTR5 offers opportunities for developing more selective agonists with improved therapeutic profiles.

The structural studies revealing distinct binding modes of different ligands and the roles of extracellular loops in mediating ligand-specific interactions highlight potential strategies for enhancing selectivity . For example, targeting specific interactions with the extracellular loops might provide a means of developing SSTR5-selective ligands that do not cross-react with other somatostatin receptor subtypes.

Future Therapeutic Applications

Beyond the established applications in neuroendocrine tumors and pituitary disorders, SSTR5-targeted drugs may have potential applications in other conditions including metabolic disorders and certain inflammatory diseases. The development of selective SSTR5 agonists, partial agonists, or biased ligands may enable more precise targeting of specific physiological processes, potentially offering therapeutic benefits with reduced off-target effects.

The pharmacological tools described earlier, such as L-362,855 and BIM-23056, provide starting points for such drug development efforts . By building on these compounds and leveraging the new structural insights, researchers may be able to develop improved SSTR5-targeted therapeutics with enhanced selectivity, potency, and pharmacokinetic properties.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific requirements may arise. Please indicate your desired format during order placement, and we will make every effort to accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice is required, kindly communicate with us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can utilize this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Typically, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms generally have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SSTR5; Somatostatin receptor type 5; SS-5-R; SS5-R; SS5R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ TSKL
Uniprot No.

Target Background

Function
Somatostatin receptor type 5 (SSTR5) serves as a receptor for somatostatin 28 and, to a lesser extent, for somatostatin-14. Its activity is mediated by G proteins that inhibit adenylyl cyclase. SSTR5 demonstrates an increase in cell growth inhibition activity upon heterodimerization with SSTR2.
Gene References Into Functions
  1. Somatostatin receptor 5 variant (sst5TMD4) was detected in a subset of breast cancers, exhibiting a correlation with angiogenic markers, lymphatic metastasis, and reduced disease-free survival. PMID: 27507050
  2. Sst5TMD4 is overexpressed in prostate cancer (PCa), particularly in patients with a worse prognosis, suggesting its potential as a biomarker or therapeutic target. PMID: 28705809
  3. In cotransfected HEK-293 cells, SSTR5 and CB1R exist in a constitutive heteromeric complex under basal conditions. This complex is disrupted upon agonist treatments, with concurrent receptor activation favoring preferential formation of SSTR5 homodimer and dissociation of CB1R homodimer. PMID: 27984180
  4. A truncated splice variant of the somatostatin receptor subtype 5 (SSTR5) is associated with increased aggressiveness in pancreatic neuroendocrine tumors. PMID: 26673010
  5. SSTR5 was the most prominently expressed receptor subtype in the cytoplasm of all growth hormone (GH)-secreting adenomas tested, regardless of octreotide treatment history (octreotide-naive, octreotide-responsive, or octreotide-resistant patients). Notably, SSTR5 mRNA predominance was significant only in octreotide-treated patients. Its expression was not correlated with baseline or post-octreotide GH or insulin-like growth factor-1 (IGF-1) levels or tumor volume. PMID: 25008035
  6. This study provides the first evidence indicating that sst5TMD4 is expressed in human medullary thyroid carcinoma cells, where it associates with more aggressive behavior. This suggests that sst5TMD4 might play a functionally relevant role. PMID: 25854304
  7. A truncated sst5 variant (sst5TMD4) can influence the secretory response of somatotropinomas to somatostatin analog therapy. PMID: 25637790
  8. SSTR5 protein is overexpressed in poorly differentiated thyroid cancer and may be involved in the lack of response to somatostatin analog treatment. PMID: 24465589
  9. High SSTR5 expression is associated with gallbladder cancer. PMID: 23991955
  10. Agonist-selective phosphorylation of carboxyl-terminal Threonine 333 of Sst5 has been reported. PMID: 23418396
  11. Research has reported down-regulation of SSTR-5 expression in operable hepatocellular carcinomas. PMID: 22640914
  12. Except for SSTR5, all somatostatin receptor subtypes showed a tendency toward decreased expression in well-to poorly differentiated neuroendocrine carcinoma of the lung. PMID: 22770972
  13. Research aimed to determine the expression of SSTR5 and establish correlations or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas. PMID: 22419713
  14. The rabbit monoclonal antibodies UMB-4 and UMB-1 facilitate the assessment of somatostatin receptor status in human tumors during routine histopathological examinations. PMID: 21952553
  15. SSTR5 P335L is a hypofunctional protein with a potentially harmful effect on function, as well as a potential latent effect, and therefore it could influence the clinical response to somatostatin analog therapy for patients with pancreatic cancer. PMID: 21249361
  16. Research demonstrated a previously undetected strong association of two SSTR5 single nucleotide polymorphisms with acromegaly. PMID: 21810856
  17. ZDHHC5 and SSTR5 are colocalized at the plasma membrane, and coexpression of ZDHHC5 increased palmitoylation of SSTR5, whereas knock-down of endogenous ZDHHC5 by siRNAs decreased it. PMID: 21820437
  18. Differential gene expression profiles revealed more abundant mRNA expression of SSTR-5 in ectopic ACTH syndrome compared to Cushing disease. PMID: 21383526
  19. Data suggest that SSTR5 genetic variants play a role in pancreatic cancer development and progression. PMID: 21692047
  20. Research demonstrated that cells transfected with SSTR1 or SSTR1/5 negatively regulate EGF-mediated effects attributed to the inhibition of EGFR phosphorylation. PMID: 21419811
  21. The heterodimerization of somatostatin receptor-5 not only indicates the receptor's specificity of interaction but also provides new insight into understanding the molecular mechanism in regulation of signaling pathways in a receptor-specific manner. PMID: 21238583
  22. These data indicate that the activation and/or overexpression of SST receptors, alongside the inhibition of EGFR, may serve as an important therapeutic approach in the treatment of ErbB-positive tumors. PMID: 21190959
  23. Common genetic variation in the IGF1 and SSTR5 genes seems to influence circulating IGF-I levels. PMID: 20810604
  24. This study demonstrated negative immunoreactivity for SSTR-5 in the adenomatous tissue. PMID: 19894022
  25. The importance of Asn13 and/or Asn26 residues in the agonist-specific signaling of hSSTR5 has been highlighted. PMID: 20207824
  26. A potential role for SSTR5 in the response of some tumors to somatostatin receptors has been suggested. PMID: 20233783
  27. SSTR5 and CCR7 have been implicated in Crohn's disease pathogenesis. PMID: 20150960
  28. Research identified an upstream promoter of the somatostatin receptor 5 gene with tissue-specific activity. PMID: 12072395
  29. The SSTR5 gene may be involved in the etiology of bipolar affective disorder or may exist in linkage disequilibrium with a susceptibility gene close to SSTR5. PMID: 12192619
  30. Results do not suggest the SSTR5 gene as a susceptibility gene for autism. PMID: 12898583
  31. Activation of hSSTR5, but not hSSTR1, is necessary for heterodimeric assembly. PMID: 15247250
  32. Genetic variation in the SSTR5 gene, particularly the rs4988483 single nucleotide polymorphism, may influence circulating IGFI and IGFBP3 hormone levels, with no measurable effect on prostate cancer risk. PMID: 15914528
  33. Intracellular sorting of the somatostatin receptor subtype 5 is regulated by interactions with PDZ domain proteins PIST/GOPC and PDZK1. PMID: 16012170
  34. Results suggest that the expression pattern of dopamine receptor 2 and somatostatin receptor 5 may influence the effects of SRIF analogs in growth hormone-secreting pituitary adenomas. PMID: 16216913
  35. The expression of SSTR5 in TSHoma may serve as a useful marker for predicting the outcome of octreotide therapy. PMID: 17159301
  36. The majority of all benign, premalignant, and malignant laryngeal specimens expressed moderate to high levels of expression of SSTR5. PMID: 18066572
  37. Immunohistochemistry study of SSTR5 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells exhibited weak positivity in the cytoplasm. PMID: 18936524
  38. SSTR5 mRNA levels in Cushing disease were greater than those in silent corticotroph adenoma (SCA) but did not differ between non-functioning pituitary tumor and SCA. PMID: 19318729
  39. Research investigated the role of BBXXB and DRY motifs of SST5 in the transduction of intracellular signals involved in the regulation of GH secretion and cell proliferation. PMID: 19342453
  40. The existence of two previously unidentified sst5 spliced variants with distinct distribution in normal tissues and pituitary tumors has been reported. PMID: 19401364
  41. Genetic variation in the SSTR5 gene, and particularly the rs4988483 single nucleotide polymorphism, influences circulating IGFI and IGFBP3 hormone levels with no measurable effect on prostate cancer risk. PMID: 19423539

Show More

Hide All

Database Links

HGNC: 11334

OMIM: 182455

KEGG: hsa:6755

STRING: 9606.ENSP00000293897

UniGene: Hs.449840

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Adult pituitary gland, heart, small intestine, adrenal gland, cerebellum and fetal hypothalamus. No expression in fetal or adult kidney, liver, pancreas, uterus, spleen, lung, thyroid or ovary.

Q&A

What is the molecular structure of recombinant human SSTR5?

Recombinant human SSTR5 is a G protein-coupled receptor (GPCR) characterized by seven transmembrane domains with an extracellular N-terminus and an intracellular C-terminus. Recent high-resolution (2.7-2.9 Å) cryo-EM studies have revealed its detailed structure when bound to different cyclic peptide agonists such as cortistatin-17 (CST17) and octreotide . The receptor contains a distinctive "hydrophobic lock" formed by residues from transmembrane helices TM3 and TM6, which undergoes rearrangement during receptor activation . This rearrangement is crucial for the outward movement of TM6, enabling Gαi protein engagement and subsequent signal transduction . Unlike other somatostatin receptors, the SSTR5 gene is intronless within its coding sequence, although variants formed by splicing of noncanonical donor and acceptor splice sites have been identified in humans, pigs, and rodents .

How does SSTR5 differ from other somatostatin receptor subtypes?

SSTR5 belongs to the SRIF1 class of somatostatin receptors along with SST2 and SST3, which is distinct from the SRIF2 class comprising SST1 and SST4 . Despite sharing structural characteristics and main intracellular signaling pathways with other somatostatin receptor subtypes, SSTR5 can be differentiated based on its specific cellular and subcellular localization, distinct modes of regulation, and unique pharmacological properties . Unlike SST1, which is incapable of homodimerization, SSTR5 can form homodimers and also heterodimers with SST1, with the latter interaction being induced by SST5-selective ligands that alter intracellular signaling compared to SSTR5 homodimers or SST1 monomers . Additionally, truncated variants of SSTR5 containing five (SST5TMD5) or four (SST5TMD4) transmembrane domains have been identified, with SST5TMD4 being overexpressed in hormone-related tumors where it increases aggressiveness .

What are the established protocols for expressing recombinant human SSTR5 in cell systems?

Recombinant human SSTR5 has been successfully expressed in various cell systems, with Chinese hamster ovary-K1 (CHO-K1) cells being commonly used for functional characterization studies . The expression process typically involves stable transfection of the SSTR5 gene into these cells to create CHOsst5 cell lines . For structural studies, insect cell expression systems have proven effective when co-expressing SSTR5 with heterotrimeric Gi protein and antibody fragments (such as scFv16) to stabilize the receptor-G protein complexes . Recent structural studies employed a variant with a 6.40L mutation in full-length SSTR5, which maintained similar activity to wild-type SSTR5 in terms of potency and efficacy while improving expression and stability for cryo-EM analysis . For functional assays, cells are typically labeled with [3H]-myo-inositol to measure total [3H]-inositol phosphate ([3H]-InsPx) accumulation in the presence of 10 mM LiCl, which serves as an indicator of receptor activation and signaling .

How can researchers effectively measure SSTR5 signaling activity in vitro?

Several methodologies are available for measuring SSTR5 signaling activity in vitro. A well-established approach involves measuring total [3H]-inositol phosphate ([3H]-InsPx) accumulation in cells labeled with [3H]-myo-inositol in the presence of 10 mM LiCl . This assay can detect time- and concentration-dependent increases in [3H]-InsPx accumulation in response to agonist stimulation, allowing for the determination of agonist potency (pEC50 values) and efficacy . The involvement of specific G proteins can be assessed by pretreating cells with pertussis toxin, which inhibits SRIF-induced [3H]-InsPx accumulation but not that induced by other stimuli like uridine 5'-triphosphate (UTP), indicating the involvement of pertussis toxin-sensitive G-proteins in SSTR5 signaling . For antagonist studies, the ability of compounds to shift agonist concentration-response curves can be measured, allowing for the determination of antagonist potency (pKB values) . Additionally, more recent studies have employed advanced techniques like cryo-EM to directly visualize receptor-G protein complexes, providing structural insights into receptor activation mechanisms .

What are the current challenges in studying SSTR5 genetic variants and polymorphisms?

Studying SSTR5 genetic variants and polymorphisms presents several challenges. Despite the important therapeutic role of SSTR5 in endocrine tumors, surprisingly few disease-associated mutations have been identified in the SRIF system genes . One significant challenge is the rarity of functionally relevant polymorphisms, with only a single acromegaly patient resistant to octreotide treatment reported to display a coding polymorphism (R240W) in SSTR5 that affected receptor signaling by disrupting G protein and MAPK signaling . Additionally, while loss of heterozygosity at the SSTR5 locus has been speculated to lead to reduced mRNA expression, the molecular mechanisms for this phenomenon have not been conclusively elucidated . Furthermore, although numerous studies have reported reduced SSTR5 expression in treatment-resistant tumors, correlations with specific polymorphisms in SSTR genes have not been established, suggesting that molecular mechanisms underlying low SSTR expression in resistant tumors likely reside in genes outside the SRIF system . Research methodologies must therefore extend beyond the SSTR5 gene itself to identify factors regulating its expression and function.

How does SSTR5 couple to G proteins and what downstream signaling pathways are activated?

SSTR5 primarily couples to pertussis toxin-sensitive G proteins, specifically the Gi family, as demonstrated by inhibition of SRIF-induced [3H]-InsPx accumulation with pertussis toxin (0.01-100 ng ml-1) . Upon activation by agonists such as SRIF, SRIF-28, or synthetic ligands like L-362,855, SSTR5 triggers a rearrangement of the "hydrophobic lock" formed by residues from transmembrane helices TM3 and TM6 . This structural reorganization causes an outward movement of TM6, enabling Gαi protein engagement and subsequent signal transduction . The activated receptor mediates activation of phosphoinositide metabolism in a pertussis toxin-sensitive manner, leading to increases in [3H]-inositol phosphate ([3H]-InsPx) accumulation . Additionally, SSTR5 signaling inhibits forskolin-stimulated cAMP production, particularly when heterodimerized with other receptors like SST1 . The signaling properties of SSTR5 can be modified through heterodimerization with other somatostatin receptors, such as SST1, which changes the intracellular signaling profile compared to SSTR5 homodimers or SST1 monomers .

How do truncated SSTR5 variants affect signaling networks in normal and disease states?

Truncated variants of SSTR5 have been identified in humans, pigs, and rodents, formed by splicing of noncanonical donor and acceptor splice sites despite the intronless nature of the SSTR5 gene . These human SSTR5 variants encode truncated receptors containing five (SST5TMD5) or four (SST5TMD4) transmembrane domains and distinct carboxyl-termini . The SST5TMD4 variant has been shown to be overexpressed in several hormone-related tumors, where it increases aggressiveness, suggesting a pathological role in tumor progression . Although the precise signaling mechanisms of these truncated variants remain to be fully elucidated, their distinct structural features, particularly their altered transmembrane domains and carboxyl-termini, likely result in modified G protein coupling, altered ligand binding properties, and different downstream signaling cascades compared to the full-length receptor. The expression of these variants in disease states may contribute to altered cellular responses to endogenous somatostatin and resistance to somatostatin analog therapies. Further research is needed to characterize the specific signaling networks affected by these truncated variants and their potential as therapeutic targets or biomarkers in hormone-related tumors.

What is the role of SSTR5 in neuroendocrine tumors and pituitary disorders?

SSTR5, along with SST2, has evolved as a primary target for the pharmacological treatment of pituitary adenomas and neuroendocrine tumors . In these conditions, SSTR5 plays a crucial role in regulating hormone secretion, with its activation typically resulting in inhibition of hormone release . The importance of SSTR5 in disease pathophysiology is underscored by the development of specific pharmacological tools targeting this receptor for therapeutic purposes . In acromegaly, a disease characterized by excessive growth hormone secretion from pituitary adenomas, SSTR5-targeting drugs are used to inhibit hormone secretion and reduce tumor size . Genetic studies have identified polymorphisms in the SSTR5 gene that may be associated with acromegaly risk and disease characteristics, although such variants are relatively rare . One notable case involved an acromegaly patient resistant to octreotide treatment who displayed a coding polymorphism in SSTR5 (R240W) that disrupted G protein and MAPK signaling, abolishing the antisecretory effects of somatostatin on SSTR5-expressing cells . Additionally, truncated SSTR5 variants, particularly SST5TMD4, have been found to be overexpressed in hormone-related tumors where they increase aggressiveness, suggesting their involvement in tumor progression and potentially treatment resistance .

How do SSTR5 polymorphisms influence patient response to somatostatin analog therapies?

SSTR5 polymorphisms can significantly influence patient response to somatostatin analog therapies, although such polymorphisms are relatively rare . The most notable example is the R240W mutation in SSTR5, which was identified in an acromegaly patient resistant to octreotide treatment . This mutation disrupts G protein and MAPK signaling, effectively abolishing the antisecretory effects of somatostatin on SSTR5-expressing cells . Beyond this specific case, loss of heterozygosity at the SSTR5 locus has been associated with reduced mRNA expression, potentially affecting receptor density and function, although the exact molecular mechanisms remain to be fully elucidated . While numerous studies have reported reduced SSTR5 expression in treatment-resistant tumors, direct correlations with specific polymorphisms in SSTR genes have not been consistently established . This suggests that mechanisms underlying low SSTR expression in octreotide- or lanreotide-resistant tumors likely involve genes outside the SRIF system . Understanding the genetic basis of variable treatment responses remains a challenge in the field, necessitating comprehensive genetic analyses beyond the SSTR5 gene itself to identify factors regulating its expression and function in disease states.

What experimental models best recapitulate SSTR5 biology for translational research?

Several experimental models have been developed to study SSTR5 biology for translational research. Cell-based systems, particularly Chinese hamster ovary-K1 (CHO-K1) cells stably expressing human recombinant SSTR5 (CHOsst5), have been widely used for functional characterization studies . These systems allow for detailed investigation of receptor-ligand interactions, signaling pathways, and pharmacological properties of various agonists and antagonists . For structural studies, insect cell expression systems have proven effective when co-expressing SSTR5 with heterotrimeric Gi protein and antibody fragments to stabilize receptor-G protein complexes . Recent advances in cryo-EM techniques have enabled high-resolution structural analysis of SSTR5 bound to different ligands, providing unprecedented insights into receptor activation mechanisms . Additionally, transgenic mouse models and patient-derived tumor cell lines have been employed to study SSTR5 function in more physiologically relevant contexts. Such models are particularly valuable for investigating the role of SSTR5 in disease processes, evaluating the efficacy of SSTR5-targeting therapies, and identifying factors contributing to treatment resistance. The combination of these diverse experimental approaches allows for comprehensive characterization of SSTR5 biology across molecular, cellular, and organismal levels, facilitating translational research aimed at developing improved therapeutic strategies for SSTR5-mediated disorders.

How do the structural insights from recent cryo-EM studies advance our understanding of SSTR5 activation?

Recent cryo-EM studies have provided groundbreaking insights into SSTR5 activation mechanisms at unprecedented resolution. The 2024 study revealing SSTR5-Gi complexes bound to cortistatin-17 and octreotide at resolutions of 2.7 Å and 2.9 Å, respectively, has significantly advanced our understanding of agonist recognition and receptor activation . These structures have revealed that binding of cyclic peptide agonists causes rearrangement of a "hydrophobic lock" consisting of residues from transmembrane helices TM3 and TM6 . This structural reorganization triggers outward movement of TM6, which is crucial for enabling Gαi protein engagement and subsequent signal transduction . The structures also revealed distinct binding modes for different ligands: cortistatin-17 forms conserved polar contacts similar to those seen with somatostatin-14 binding to SSTR2, while octreotide interacts differently with the extracellular loops . These structural differences help explain the principles of agonist selectivity and receptor subtype specificity . Furthermore, the detailed mapping of ligand-receptor interactions provides valuable insights for structure-based drug design, potentially leading to the development of more selective and efficacious SSTR5 agonists for treating neuroendocrine tumors and pituitary disorders .

What are the emerging applications of SSTR5-targeted therapies beyond traditional indications?

While SSTR5 has traditionally been targeted for neuroendocrine tumors and pituitary disorders, emerging research suggests potential applications in additional therapeutic areas. The development of orally available and subtype-selective SST agonists and antagonists in recent years has opened new possibilities for SSTR5-targeted therapies . Some of these substances may become lead compounds for novel therapeutic indications directed toward individual somatostatin receptors, including SSTR5 . Beyond oncology, SSTR5 is being investigated for its potential role in metabolic disorders, given its expression in pancreatic islets and involvement in insulin regulation. Additionally, the identification of truncated SSTR5 variants like SST5TMD4, which are overexpressed in hormone-related tumors and associated with increased aggressiveness, suggests potential applications in targeting specific SSTR5 variants for cancer therapy . The structural insights gained from recent cryo-EM studies are expected to facilitate the development of improved SSTR5 agonists with enhanced selectivity profiles, potentially expanding the therapeutic utility of SSTR5-targeted compounds . As our understanding of SSTR5 biology continues to evolve, additional applications in neurological, inflammatory, and autoimmune conditions may emerge, further broadening the therapeutic landscape for SSTR5-targeted interventions.

What methodological advances are needed to better characterize SSTR5 interactions with other cellular components?

Despite significant progress in understanding SSTR5 biology, several methodological advances are needed to better characterize its interactions with other cellular components. Advanced imaging techniques capable of visualizing receptor dimerization, trafficking, and compartmentalization in live cells would provide valuable insights into the dynamic regulation of SSTR5 function. Single-molecule imaging approaches could help elucidate the stoichiometry and kinetics of SSTR5 interactions with G proteins, arrestins, and other signaling molecules. Improved methods for detecting and quantifying low-abundance receptor variants and polymorphisms would facilitate more comprehensive genetic studies and potentially reveal previously unrecognized associations with disease phenotypes. Additionally, the development of more selective tools for probing SSTR5 function, such as subtype-specific antibodies, nanobodies, and pharmacological agents, would enable more precise dissection of SSTR5-specific signaling pathways in complex cellular environments. Computational approaches integrating structural, pharmacological, and genetic data could help predict receptor-ligand interactions and guide rational drug design efforts. Finally, advanced gene-editing technologies like CRISPR-Cas9 could facilitate the creation of more accurate disease models for studying SSTR5 function in relevant physiological contexts. These methodological advances would collectively enhance our ability to characterize SSTR5 interactions with various cellular components and potentially lead to the development of more effective therapeutic strategies targeting this receptor.

What are the most significant knowledge gaps in SSTR5 research?

Despite substantial progress in SSTR5 research, several significant knowledge gaps remain. The precise mechanisms by which SSTR5 polymorphisms and variants influence disease susceptibility and treatment response require further investigation, as current studies have identified relatively few disease-associated mutations . The molecular basis for reduced SSTR5 expression in treatment-resistant tumors remains poorly understood, with evidence suggesting that factors beyond the SSTR5 gene itself may be involved . Additionally, while recent structural studies have provided valuable insights into SSTR5 activation by specific ligands , the structural dynamics of the receptor across different activation states and in complex with diverse ligands remain to be fully characterized. The functional significance of SSTR5 dimerization with other somatostatin receptors in physiological and pathological contexts needs further exploration, as does the role of truncated SSTR5 variants like SST5TMD4 in disease progression . Furthermore, the cross-talk between SSTR5 and other signaling pathways in complex cellular environments remains incompletely understood. Addressing these knowledge gaps will require integrated approaches combining structural biology, genetics, pharmacology, and cellular physiology, ultimately advancing our understanding of SSTR5 biology and its therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.