Recombinant Human Sperm-associated antigen 4 protein (SPAG4)

Shipped with Ice Packs
In Stock

Description

Introduction

Sperm-associated antigen 4 (SPAG4), a member of the cancer-testis antigen (CTA) family, has garnered interest as a potential cancer marker . SPAG4's role in spermatogenesis has been established, specifically in sperm head formation . Recent research indicates that SPAG4 is highly expressed in various tumors and may serve as a biomarker for cancer detection, prognosis, treatment design, and follow-up .

Gene Information

  • Name: Sperm associated antigen 4

  • Symbol: SPAG4

  • Alias: CT107, SPAG4L

  • HGNC: 11214

  • OMIM: 603038

  • KEGG: hsa:6676

  • STRING: 9606.ENSP00000363391

  • UniGene: Hs.123159

Expression Analysis

Western blot analysis using clinical tumor samples has confirmed the increased SPAG4 protein levels in colon adenocarcinoma (COAD), liver hepatocellular carcinoma (LIHC), and breast cancer (BRCA) samples .

Role in Spermatogenesis

SPAG4 is involved in spermatogenesis and is required for sperm head formation . A related protein, SPAG4L, may play a crucial role in the meiotic stage of spermatogenesis as well .

5.1. Expression in Tumors

SPAG4 is highly expressed in multiple human tumors . It has been identified as a cancer biomarker for glioblastoma and a potential prognostic marker for lung squamous cell carcinoma (LUSC) . High SPAG4 expression is also associated with a poorer prognosis in most tumors .

5.2. Immune Microenvironment

SPAG4 plays a role in the tumor immune microenvironment and is involved in regulating the immune microenvironment . SPAG4 expression correlates with the degree of immune infiltration, immune cell markers, common immune checkpoints, tumor mutational burden (TMB), and microsatellite instability (MSI) in various tumors . It also correlates with immunosuppressive regulatory cells, suggesting a potential role in regulating immune escape in tumors .

5.4. Therapeutic Potential

SPAG4 expression affects the sensitivity of tumor cell lines to various drugs . High SPAG4 expression can lead to reduced sensitivity to immune checkpoint inhibitors such as PD-1 and CTLA-4, while showing the opposite result for PD-L1 .

7.1. Drug Sensitivity and Resistance

SPAG4 expression is associated with drug sensitivity in cancer cells . For example, high SPAG4 expression is correlated with sensitivity to bortezomib, doxorubicin, cisplatin, and gemcitabine, but is associated with resistance to oxaliplatin in colorectal cancer patients .

7.2. Immune Checkpoint Inhibitor Therapy

The predictive role of SPAG4 in cancer patients treated with immune checkpoint inhibitors (ICIs) has been analyzed . High SPAG4 expression may reduce the sensitivity of tumor patients to immunosuppression of PD-1 and CTLA-4 but shows the opposite result for PD-L1 . In GBM, KIRC, and melanoma, SPAG4 expression is positively correlated with cytotoxic T lymphocytes (CTLs) infiltration, but patients with low SPAG4 expression have a better prognosis after immune checkpoint blockade (PD-1 or PD-L1) treatment .

Statistical Analysis

Statistical analyses are performed using software such as SPSS version 24.0 . The association between SPAG4 expression and clinicopathological features is assessed using Pearson's Chi-square test or Fisher's exact test . P-values less than 0.05 are considered statistically significant .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAG4; SUN4; Sperm-associated antigen 4 protein; Outer dense fiber-associated protein SPAG4; SUN domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SPAG4
Target Protein Sequence
MRRSSRPGSASSSRKHTPNFFSENSSMSITSEDSKGLRSAEPGPGEPEGRRARGPSCGEP ALSAGVPGGTTWAGSSQQKPAPRSHNWQTACGAATVRGGASEPTGSPVVSEEPLDLLPTL DLRQEMPPPRVFKSFLSLLFQGLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLSA FWLGLLYLVSPLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSER VAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTV ILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFG LQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRA HGVRTSEGAEGSAQGPH
Uniprot No.

Target Background

Function

SPAG4 is involved in spermatogenesis, specifically sperm head formation. While not essential for establishing or maintaining general sperm head polarity, it is crucial for manchette anchoring and organization. It plays a role in targeting SUN3 and likely SYNE1 to the nuclear envelope via a potential SUN1:SYNE3 LINC complex, ensuring accurate posterior sperm head localization of this complex. SPAG4 may anchor SUN3 to the nuclear envelope and contribute to maintaining nuclear envelope integrity. It may also aid in the organization and assembly of outer dense fibers (ODFs) in the sperm tail.

Gene References Into Functions
  1. SPAG4, in collaboration with Nesprin3, plays a significant role in lung carcinoma cell migration. PMID: 29901114
  2. SPAG4 knockdown diminishes the invasive capacity of renal cell carcinoma (RCC) cells. PMID: 23818324
  3. SPAG4 serves as an independent prognostic marker in renal cell carcinoma and is vital in cytokinesis, protecting against hypoxia-induced tetraploid formation. PMID: 23602831
Database Links

HGNC: 11214

OMIM: 603038

KEGG: hsa:6676

STRING: 9606.ENSP00000363391

UniGene: Hs.123159

Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, flagellum axoneme. Nucleus envelope. Nucleus inner membrane.
Tissue Specificity
Predominantly epressed in testis. Expressed in ejaculated spermatozoa (at protein level).

Q&A

What is the genomic organization and basic structure of human SPAG4?

SPAG4 is a 12-exon gene spanning approximately 5.2 kb on chromosome 20q11.23. It belongs to the SUN (Sad1 and UNC-84) family of proteins, which are characterized by a conserved C-terminal SUN domain. SPAG4 is localized in the inner nuclear membrane and functions as a mediating protein between the nucleoskeleton and cytoskeleton, forming part of the LINC (Linker of Nucleoskeleton and Cytoskeleton) complex .

What are the known physiological functions of SPAG4 in normal tissues?

SPAG4 was first identified in mammalian sperm tails where it interacts specifically with the outer dense fiber 27 (ODF27) protein. It plays important roles in spermatogenesis and sperm motility. Under normal conditions, SPAG4 expression is limited to a few tissues, most notably the pancreas and testis. It participates in nuclear remodeling, nuclear membrane integrity maintenance, and sperm tail development .

What protein-protein interactions has SPAG4 been shown to participate in?

SPAG4 has been demonstrated to interact with several proteins including:

  • Outer dense fiber 27 (ODF27) in sperm cells

  • Nesprin3, which influences the migration of lung tumor cells

  • Components of the LINC complex that connect the nucleoskeleton and cytoskeleton

Researchers can identify additional interaction partners using co-immunoprecipitation (Co-IP) and bimolecular fluorescence complementation (BiFC) techniques as described in the literature .

What are the recommended methods for detecting SPAG4 expression in tissue samples?

Multiple validated approaches exist for SPAG4 detection:

MethodApplicationKey Considerations
Western blottingProtein expression quantificationUse anti-SPAG4 antibodies at 1:50 dilution
Immunohistochemistry (IHC)Tissue localizationUse SP ready-to-use kit; counterstain with hematoxylin
RT-qPCRmRNA expression analysisValidated primers available in literature
ImmunofluorescenceSubcellular localizationCan be combined with other markers

For IHC, researchers should follow protocols similar to those described by Ji et al., using rabbit anti-hSPAG4 antibody (1:50 dilution) followed by biotin-labeled goat anti-rabbit/mouse IgG and streptavidin peroxidase .

How can I quantify SPAG4 expression differences between normal and cancerous tissues?

For accurate quantification and statistical comparison:

  • Collect paired tumor and adjacent normal tissues from the same patient when possible

  • Use RT-qPCR with appropriate housekeeping genes (GAPDH, β-actin) for normalization

  • Apply western blotting with densitometry analysis for protein level comparison

  • Employ statistical methods such as paired t-tests for matched samples

  • Consider employing The Cancer Genome Atlas (TCGA) database for larger cohort analysis

Wang et al. demonstrated significant overexpression of SPAG4 in LUSC tissue samples compared with paired para-cancerous histological normal tissues using RT-qPCR, validating findings from database analysis .

What is the evidence supporting SPAG4 as a cancer biomarker?

SPAG4 has been identified as a potential biomarker in multiple cancer types:

  • Lung cancer: High expression in lung adenocarcinoma tissues compared to normal tissue

  • Lung squamous cell carcinoma (LUSC): Overexpression correlates with poor prognosis (HR = 1.038, p = 0.04)

  • Glioblastoma (GBM): Higher expression in tumor tissue compared to adjacent normal tissues

  • Renal cell carcinoma: Expression correlated with prognosis

  • Multiple other cancer types: Significant upregulation across various neoplastic tissues

How does SPAG4 contribute to tumor progression at the molecular level?

Several mechanisms have been identified:

  • In lung cancer:

    • Interacts with Nesprin3 to promote cell migration

    • Acts as a positive regulator of Nesprin3 location and expression

    • Silencing of either SPAG4 or Nesprin3 reduces migration of A549 cells

  • In glioblastoma:

    • Modulates fatty acid metabolism pathways

    • Enhances migration, invasion, and proliferation capabilities

    • Reduces oxidative stress levels

    • Facilitates immune evasion by increasing CD47 expression

    • Reduces macrophage phagocytosis

  • General mechanisms:

    • May activate MEK/ERK signaling pathway in some cancers

    • Plays a role in defending against hypoxia-induced tetraploid formation

What gene knockdown/knockout strategies are effective for studying SPAG4 function?

Several validated approaches have been reported:

TechniqueApplicationConsiderations
siRNA transfectionTransient knockdownEffective in A549, U87, U251 cell lines; requires optimization of transfection conditions
shRNA lentiviral vectorsStable knockdownUsed successfully for in vivo xenograft models; requires virus production and selection
CRISPR-Cas9Complete knockoutFor long-term studies; requires validation of complete knockout

For siRNA experiments, researchers should verify knockdown efficiency via western blot and RT-qPCR. Published studies report significant functional effects with >70% knockdown efficiency .

How can I effectively study SPAG4's role in cell migration and invasion?

Multiple validated assays have been used successfully:

  • Wound healing (scratch) assay:

    • Used to assess migration in U87, U251, and A549 cells

    • SPAG4 knockdown shows delayed healing compared to controls

  • Transwell invasion assay:

    • Demonstrates that SPAG4 knockdown reduces invasive capacity of cancer cells

    • Matrigel-coated chambers recommended for consistent results

  • In vivo xenograft models:

    • Subcutaneous implantation of sh-SPAG4 treated cancer cells shows reduced tumor volume

    • Allows for assessment of SPAG4's role in tumor growth and immune microenvironment

How does SPAG4 modulate the tumor immune microenvironment?

Recent research has revealed SPAG4's complex role in immune modulation:

  • SPAG4 expression shows positive correlation with:

    • MRC1 (R=0.26, p-value=1.5e-5)

    • CD47 (R=0.33, p-value=1.8e-5) in GBM

  • SPAG4 knockdown in mouse models results in:

    • Increased M1 macrophage (iNOS) phenotype

    • Decreased M2 macrophage (CD206) phenotype

  • Mechanistically, SPAG4:

    • Increases CD47 levels through promotion of fatty acid oxidation

    • Reduces macrophage phagocytosis through CD47 upregulation

    • Contributes to immune evasion in the tumor microenvironment

Researchers can investigate these interactions through co-culture experiments with macrophages and SPAG4-modulated cancer cells, using phagocytosis assays with appropriate inhibitors.

What is the relationship between SPAG4 and metabolic reprogramming in cancer cells?

SPAG4 appears to significantly influence cancer cell metabolism:

  • Single-cell sequencing data analysis reveals enrichment of SPAG4-expressing cells in pathways related to:

    • Fatty acid metabolism (GO biological process)

    • Lipid droplets (GO cellular component)

    • Fatty acid binding (GO molecular function)

    • Lipid metabolism and atherosclerosis (KEGG pathway)

  • SPAG4 expression correlates positively with metabolism-related genes:

    • CD36

    • SLC43A3

    • SLC2A1

    • MYD88

  • Experimental evidence shows:

    • SPAG4 overexpression increases fatty acid content in cancer cells

    • SPAG4 knockout decreases fatty acid content

    • Treatment with fatty acid oxidation inhibitor (Orlistat) reverses SPAG4-mediated effects on migration, invasion, and proliferation

To investigate these relationships, researchers should consider measuring cellular lipid content (Oil-red staining), assessing triglyceride levels, and employing metabolic inhibitors in functional assays.

What expression systems are optimal for producing recombinant human SPAG4 protein?

While specific expression systems for SPAG4 are not detailed in the provided search results, general recommendations based on similar proteins include:

  • Mammalian expression systems (HEK293, CHO cells):

    • Advantages: Proper folding and post-translational modifications

    • Considerations: Higher cost, lower yield compared to bacterial systems

  • Bacterial expression (E. coli):

    • Advantages: Higher yield, cost-effective

    • Considerations: Potential improper folding, lack of post-translational modifications

  • Baculovirus-insect cell system:

    • Advantages: Higher expression levels than mammalian cells with proper folding

    • Considerations: More complex than bacterial systems

For functional studies requiring properly folded protein with post-translational modifications, mammalian expression systems are recommended.

What purification strategies work best for recombinant SPAG4 protein?

Based on general recombinant protein purification approaches and information from the SPAG4 sequence:

  • Affinity chromatography:

    • His-tagged SPAG4 can be purified using Ni-NTA or IMAC columns

    • Consider using a C-terminal 6-His tag as demonstrated in other recombinant proteins

  • Size exclusion chromatography:

    • Secondary purification step to obtain higher purity

    • Helps remove protein aggregates and degradation products

  • Storage and stability:

    • Lyophilization from filtered solution in appropriate buffer (e.g., NaH₂PO₄ and NaCl)

    • Reconstitution at 100 μg/mL in sterile PBS

    • Avoid repeated freeze-thaw cycles

What statistical approaches are appropriate for analyzing SPAG4 expression in patient cohorts?

Based on published studies, the following statistical methods have proven effective:

  • For survival analysis:

    • Kaplan-Meier curves with log-rank test to compare survival between high and low SPAG4 expression groups

    • Cox proportional hazards regression for univariate and multivariate analyses

    • Hazard ratios (HR) with 95% confidence intervals to quantify risk

  • For expression comparison:

    • Paired t-test for matched tumor/normal samples

    • Mann-Whitney U test for non-parametric comparison

    • ANOVA with post-hoc tests for multiple group comparison

  • For predictive model development:

    • ROC curve analysis to assess predictive performance (AUC calculation)

    • Random survival forests (RSF) algorithm to evaluate relative importance of genes in multigene models

Software packages recommended include SPSS version 24.0, R software (version 3.6.1 or later), and appropriate bioinformatics tools for complex analyses .

How can I address variability in SPAG4 expression data across different patient samples?

  • Sample size calculation: Perform a priori power analysis to determine adequate sample size for detecting expected effect sizes with sufficient statistical power

  • Control for confounding variables:

    • Include clinicopathological factors (age, gender, TNM stage) in multivariate analyses

    • Use propensity score matching for balanced comparison groups

  • Standardization approaches:

    • Use relative expression (fold change) rather than absolute values

    • Apply appropriate normalization with validated reference genes

    • Consider log-transformation for non-normal distributions

  • Meta-analysis techniques:

    • When combining data from multiple sources, use random-effects models to account for between-study heterogeneity

    • Test for publication bias using funnel plots and Egger's test

What are promising therapeutic approaches targeting SPAG4 in cancer?

Based on current understanding of SPAG4 biology, several therapeutic strategies warrant investigation:

  • Direct targeting:

    • Small molecule inhibitors disrupting SPAG4-Nesprin3 interaction

    • Peptide-based inhibitors targeting key functional domains

    • Antisense oligonucleotides or siRNA therapeutic delivery

  • Metabolic intervention:

    • Fatty acid oxidation inhibitors (like Orlistat) in combination with SPAG4-targeting approaches

    • Exploration of synergistic effects with glycolysis inhibitors

  • Immune-based strategies:

    • Combination of SPAG4 inhibition with anti-CD47 therapy to enhance macrophage phagocytosis

    • Evaluation of SPAG4 as a target for chimeric antigen receptor (CAR) T-cell therapy

  • Biomarker application:

    • Development of SPAG4-based prognostic scoring systems

    • Identification of patient subgroups most likely to benefit from SPAG4-targeted therapies

What key questions remain unresolved in SPAG4 research?

Despite significant progress, several important questions require further investigation:

  • Structure-function relationships:

    • Crystal structure of SPAG4 and its interaction domains

    • Identification of critical residues for protein-protein interactions

  • Tissue-specific functions:

    • Comprehensive characterization of SPAG4's role across different normal tissues

    • Understanding why SPAG4 is pathogenic in some contexts but not others

  • Regulatory mechanisms:

    • Transcriptional regulation of SPAG4 expression

    • Post-translational modifications affecting SPAG4 function

    • Role of hypoxia and HIF1 in regulating SPAG4 expression

  • Evolutionary conservation:

    • Functional comparison of SPAG4 across species (like the Drosophila homolog)

    • Evolutionary pressure driving SPAG4 conservation

  • Clinical translation:

    • Validation in larger, diverse patient cohorts

    • Development of standardized SPAG4 detection methodologies for clinical application

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.