Recombinant Human Spermatid maturation protein 1 (SPEM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPEM1; C17orf83; Spermatid maturation protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SPEM1
Target Protein Sequence
MAMVERPRPEWASYHNCNSNSCQDLGNSVLLLLGLIICINISINIVTLLWSRFRGVLYQV FHDTICEKEAPKSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTR CAHCPVAWAPDTDDEKPHQYPAICSYHWDVPEDWEGFQHTQGTWVPWSQDAPESPPQTIR FQPTVEERPLKTGIWSELGLRAYVYPVNPPPPSPEAPSHKNGGEGAVPEAEAAQYQPVPA PTLGPAVIPEFSRHRSSGRIVYDARDMRRRLRELTREVEALSGCYPLASGSSTAEETSKN WVYRSLTGR
Uniprot No.

Target Background

Function
Essential for efficient cytoplasm removal during spermatogenesis.
Database Links

HGNC: 32429

OMIM: 615116

KEGG: hsa:374768

STRING: 9606.ENSP00000315554

UniGene: Hs.710599

Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is the biological function of SPEM1 in spermatogenesis?

SPEM1 is a protein exclusively expressed in the cytoplasm of steps 14-16 elongated spermatids in the testis. It plays a critical role in proper cytoplasm removal during spermiogenesis (the final stage of spermatogenesis). Studies using knockout mouse models have demonstrated that SPEM1 is essential for:

  • Facilitating cytoplasm loosening and detachment from the head and neck region of developing spermatozoa

  • Enabling proper straightening of the sperm head and stretching of the growing tail

  • Ensuring correct morphological development of mature spermatozoa

Without SPEM1, cytoplasmic components fail to detach properly, mechanically obstructing normal sperm development and resulting in characteristic deformations where the sperm head becomes bent and wrapped around by the neck and middle piece of the tail .

What experimental approaches are most effective for studying SPEM1 expression patterns?

Several complementary techniques have proven effective for characterizing SPEM1 expression:

In situ hybridization:

  • Using SPEM1-specific antisense riboprobes to detect mRNA expression

  • Reveals stage-specific expression patterns (lower/absent intensity at stages V-VII)

  • Shows hybridization signals confined to haploid cells in the luminal compartment (steps 6-15 spermatids)

Immunohistochemistry:

  • Using polyclonal antibodies against full-length SPEM1 protein

  • Reveals stronger immunoreactivity at stages III-VII and weaker signals at stages I, II, and VIII

  • Confirms SPEM1 localization specifically in the cytoplasm of steps 14-16 spermatids

Western blotting:

  • For detecting SPEM1 protein in tissue lysates and confirming knockout models

  • Can detect temporal expression patterns during spermatogenesis

These approaches should be combined for comprehensive expression analysis, as SPEM1 shows delayed protein expression relative to mRNA levels, a common phenomenon for genes functioning during late spermiogenesis .

How can SPEM1 knockout mouse models be generated and characterized?

Generation of SPEM1 knockout mice has been achieved through the following methodology:

Targeting vector construction:

  • Design a construct to delete the entire SPEM1 gene (except for the last 88 bp of exon 3)

  • Include the 5' UTR, exons 1-3, and introns in the deleted region to ensure complete functional nullification

Verification of knockout:

  • Southern blot analysis using 5' external probes (KO allele: 5.1-kb band; WT allele: 11.5-kb band)

  • Internal 3' probe verification

  • PCR-based genotyping for routine screening

  • RT-PCR and Western blot confirmation of absence of SPEM1 mRNA and protein

Phenotypic characterization:

  • Light microscopy analysis of sperm morphology (to detect head-bent-back abnormalities)

  • Fertility testing through natural mating trials

  • Electron microscopy to analyze ultrastructural defects

  • ICSI (intracytoplasmic sperm injection) to test fertilization capability when bypassing motility issues

This comprehensive approach ensures proper characterization of the knockout phenotype and confirmation of functional nullification of the SPEM1 gene .

What is known about SPEM1's molecular interactions and signaling pathways?

SPEM1 appears to function through protein-protein interactions that regulate cytoplasmic removal during spermiogenesis:

Interaction with UBQLN1:

  • Yeast two-hybrid screening has identified UBQLN1 as a SPEM1-interacting partner

  • UBQLN1 and SPEM1 are colocalized to the manchette of elongating spermatids

  • UBQLN1 functions by binding and directing poly-ubiquitinated proteins to the proteasome for degradation

  • This interaction suggests SPEM1 may regulate protein ubiquitination during spermiogenesis

Potential relationships with other pathways:

  • The phenotype of SPEM1-null mice resembles that of mice deficient in nuclear packaging proteins (TNP1, TNP2, PRM1, PRM2, H1t2)

  • This suggests cross-talk between nuclear condensation and cytoplasmic removal pathways

  • SPEM1 may be involved in coordinating these processes during late spermiogenesis

Further investigation using techniques like co-immunoprecipitation, proximity ligation assays, and proteomic analysis could help elucidate the complete interactome of SPEM1 .

How does SPEM1 expression correlate with specific stages of spermiogenesis?

SPEM1 shows highly regulated, stage-specific expression during spermatogenesis:

Spermatogenic StageSPEM1 mRNA ExpressionSPEM1 Protein Expression
SpermatogoniaNot detectedNot detected
SpermatocytesNot detectedNot detected
Steps 6-13 spermatidsDetectedMinimal/not detected
Steps 14-16 spermatidsHighStrong
Stages III-VIIVariableStronger immunoreactivity
Stages I, II, VIIIVariableWeaker signals
Post-spermiation (IX-X)Not detectedMostly removed into residual bodies

This expression pattern reveals:

  • Transcriptional activation occurs earlier than protein expression

  • mRNA is transcribed before transcription ceases at step 9 when chromatin condensation begins

  • Protein functions primarily during late spermiogenesis rather than posttesticular maturation

  • SPEM1 is removed into residual bodies after spermiation

This unique temporal pattern is consistent with SPEM1's role in the final stages of spermatid maturation and cytoplasm removal .

What is the predictive value of SPEM1 as a marker for sperm retrieval in azoospermic men?

SPEM1 has demonstrated exceptional value as a predictive marker for sperm retrieval in azoospermic patients:

Clinical study findings:

  • Among seven testis-specific molecular markers examined (ESX1, DAZ, DAZL, ZMYND15, PRM1, TNP1, and SPEM1), SPEM1 showed the highest predictive power

  • Positive prediction power: 96%

  • Negative prediction power: 85%

  • Area under the curve (AUC) of 0.91 for ROC to predict micro-TESE outcomes

  • Optimal cutoff value: 0.086

Comparative advantage:

  • Post-meiotic SPEM1 expression is significantly reduced in negative vs. positive sperm retrieval groups

  • Expression of post-meiotic transcripts significantly decreases in NOA (nonobstructive azoospermia) and its subgroups with spermatogenic failure

  • SPEM1 shows higher specificity for late-stage spermatogenesis than other markers

These findings suggest SPEM1 could be an invaluable molecular marker for clinical decision-making regarding sperm retrieval procedures in azoospermic men .

How can recombinant SPEM1 be utilized for functional studies?

Recombinant SPEM1 protein provides opportunities for various functional studies:

Production methods:

  • Expression in bacterial systems (E. coli) for human SPEM1

  • Purification using affinity chromatography

  • Quality control through SDS-PAGE (>85% purity)

Potential applications:

  • Binding assays to identify interaction partners

  • In vitro assays to test effects on sperm function and morphology

  • Generation of monoclonal or polyclonal antibodies for detection studies

  • Structure-function studies of SPEM1 domains

  • Comparison with other recombinant proteins (like β-defensin 1) that have been shown to maintain sperm viability and motility in vitro

Experimental considerations:

  • Storage at -20°C/-80°C (shelf life of liquid form: 6 months; lyophilized form: 12 months)

  • Avoiding repeated freeze-thaw cycles

  • Reconstitution in appropriate buffers

This approach allows detailed molecular characterization without relying solely on genetic knockout models .

What structural features of SPEM1 contribute to its function in spermiogenesis?

SPEM1 has several notable structural characteristics:

Sequence features:

  • Contains no known functional domains

  • Highly conserved across mammalian species

  • The human SPEM1 protein consists of 262 amino acids

  • Alternative names include "Spermatid-specific manchette-related protein 1," "Ciliated bronchial epithelial protein 1," and "Testis development protein NYD-SP22"

Evolutionary conservation:

  • Sequence alignment of SPEM1 orthologs from mouse, rat, dog, cow, chimpanzee, and human reveals high conservation

  • This suggests critical functional importance despite the lack of recognized domains

Localization determinants:

  • Contains sequences that target it specifically to the cytoplasm of elongated spermatids

  • May have unidentified interaction motifs that mediate binding to UBQLN1 and potentially other partners

Further structural studies, including crystallography or cryo-EM analysis, would be valuable to understand how SPEM1's structure relates to its function in cytoplasm removal .

How does SPEM1 deficiency affect embryonic development following fertilization?

Studies using SPEM1 knockout models have revealed impacts beyond sperm formation:

Fertilization and embryonic development:

  • SPEM1-deficient sperm show severely reduced motility and morphological abnormalities

  • Intracytoplasmic sperm injection (ICSI) using SPEM1-null sperm results in significantly impaired blastocyst formation (13.5% vs. 48.0% with wild-type sperm)

  • Two significant developmental blocks are observed:

    • First block: 1-cell to 2-cell transition

    • Second block: morula to blastocyst stages

Molecular mechanisms:

  • SPEM1 deficiency affects sperm chromatin composition and histone eviction

  • Mutant embryos show premature dismissal of protamine 1 (P1) from paternal chromatin

  • The K49A mutation in protamine 1 alters P1 affinity for DNA, decreasing rates of DNA condensation and accelerating de-condensation

These findings suggest SPEM1 has important implications for embryonic development, possibly through effects on chromatin packaging that persist even after fertilization .

What approaches can be used to study SPEM1 in human male infertility?

Several methodological approaches are valuable for investigating SPEM1's role in human male infertility:

Clinical sample analysis:

  • RT-qPCR analysis of testicular biopsies from azoospermic men to evaluate SPEM1 expression

  • ROC curve analysis to determine optimal diagnostic cutoff values for predicting sperm retrieval

  • Comparison of SPEM1 expression across different histopathological categories (SCOS: Sertoli cell only syndrome, MA: maturation arrest, and HS: hypospermatogenesis)

Single-cell analysis:

  • Integration of scRNA-seq data to identify cell-specific expression patterns

  • High-resolution spatial proteomics and multiplex immunohistochemistry (mIHC)

  • Pseudo-time trajectory analysis to track SPEM1 expression during spermatogenesis progression

Functional validation:

  • In vitro assays using recombinant human SPEM1 protein

  • Comparison with other sperm function-enhancing proteins like β-defensin 1

  • Analysis of SPEM1 interaction with the ubiquitin-proteasome pathway

These complementary approaches can provide comprehensive insights into SPEM1's role in human male infertility while overcoming the limitations of each individual method .

How might the function of SPEM1 differ between rodent models and humans?

Important species-specific considerations for SPEM1 research include:

Evolutionary conservation and divergence:

  • While SPEM1 is highly conserved across mammalian species, there are structural differences

  • Sequence alignment reveals conservation within rodent lineages but greater divergence in primates

  • Specific post-translational modifications sites (like P1 K49 acetylation) are conserved within species but not across species

Expression patterns:

  • Mouse SPEM1 is expressed exclusively in steps 14-16 elongated spermatids

  • Human SPEM1 (also called SMRP1) shows expression in adult testes and possibly ciliated bronchial epithelial cells

  • Alternative splicing has been observed in humans with three transcript variants encoding distinct isoforms

Experimental implications:

  • Findings from mouse knockout models may not translate directly to human fertility disorders

  • Human SPEM1 may have additional functions beyond spermatogenesis

  • Single-cell and spatial transcriptomics approaches can help identify species-specific expression patterns

These differences highlight the importance of complementing rodent model studies with human tissue analyses when investigating SPEM1's role in fertility disorders .

What methods can be used to investigate post-translational modifications of SPEM1?

Post-translational modifications (PTMs) may significantly impact SPEM1 function and can be studied through:

Mass spectrometry approaches:

  • Top-down and bottom-up mass spectrometry to identify specific PTMs

  • Comparative analysis of PTMs in normal versus pathological samples

  • Temporal analysis of PTM acquisition during spermatid development

Immunological detection:

  • Generation of modification-specific antibodies (e.g., anti-acetylated SPEM1)

  • Co-immunoprecipitation to identify proteins that interact with modified SPEM1

  • Immunohistochemistry to localize modified SPEM1 in testicular sections

Functional studies:

  • Site-directed mutagenesis to create modification-resistant SPEM1 variants

  • In vitro assays comparing wild-type and modification-resistant variants

  • Protein-protein interaction studies to identify readers of specific modifications

Understanding SPEM1's post-translational modifications could provide insights into its regulation and mechanism of action during spermiogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.