Recombinant Human Spermatogenesis-associated protein 25 (SPATA25)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
SPATA25; C20orf165; TSG23; Spermatogenesis-associated protein 25; Testis-specific gene 23 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SPATA25
Target Protein Sequence
MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQA WGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPS RPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWA AQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCL
Uniprot No.

Target Background

Function
Potentially involved in spermatogenesis.
Gene References Into Functions
  1. A study identified a novel gene, TSG23/Tsg23, exhibiting developmental and high expression in the testis. Findings suggest its involvement in human and mouse spermatogenesis. PMID: 19240080
Database Links

HGNC: 16158

KEGG: hsa:128497

STRING: 9606.ENSP00000361597

UniGene: Hs.128235

Protein Families
SPATA25 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed predominantly in testis (at protein level). Expression is lower in patients with obstructive azoospermia than in fertile controls and is not detected in patients with non-obstructive azoospermia.

Q&A

What is SPATA25 and what is its role in spermatogenesis?

Spermatogenesis-associated protein 25 (SPATA25) is a gene product involved in the complex process of sperm cell development. It functions within the broader context of spermatogenesis, which is a highly regulated cell differentiation process responsible for the production of fertilizing sperm that can ultimately fuse with an egg to form a zygote . SPATA25 is one of several genes that regulate normal spermatogenesis, contributing to the molecular interactions between developing germ cells and somatic Sertoli cells that support this process . While not exclusively expressed in testicular tissue, SPATA25 has been identified as having specialized functions in male reproductive biology. Current research suggests that loss-of-function mutations in spermatogenesis-related genes like SPATA25 can potentially result in spermatogenesis defects and compromised sperm functionality .

How is SPATA25 expression regulated during normal spermatogenesis?

SPATA25 expression follows a specific pattern throughout the spermatogenic process. The protein appears to be regulated as part of the molecular machinery that controls the transition from diploid spermatogonia to haploid motile sperm . This regulation occurs within the unique testicular microenvironment where Sertoli cells provide both structural support and essential nutrients for the developing germ cells .

The expression of SPATA25 must be precisely coordinated with other spermatogenesis-associated proteins to ensure proper sperm development. Research indicates that this regulation involves complex interactions between hormonal signaling pathways, transcription factors, and epigenetic modifications. Of particular importance is the balance of reactive oxygen species (ROS) in testicular tissue, as spermatogenesis involves continuous cell proliferation and high enzymatic activity that make testes susceptible to oxidative stress . This oxidative environment can potentially affect SPATA25 expression patterns and functionality during the different stages of sperm development.

What cellular processes most prominently involve SPATA25?

SPATA25 appears to be involved in several critical cellular processes necessary for proper spermatogenesis:

  • Protection against oxidative damage - The testicular environment contains high levels of unsaturated fatty acids and exhibits continuous cell proliferation, making it susceptible to oxidative stress . SPATA25 may play a role in managing reactive oxygen species (ROS) that could otherwise compromise sperm count or DNA integrity.

  • Sperm cell differentiation - As a spermatogenesis-associated protein, SPATA25 likely contributes to the series of concerted molecular interactions between developing germ cells and Sertoli cells that drive the differentiation process .

  • Lipid metabolism - Research suggests potential involvement in pathways related to docosahexaenoic acid (DHA) synthesis and peroxisomal β-oxidation, which are important for sperm membrane development .

  • Nuclear DNA packaging - During spermiogenesis, SPATA25 may participate in the extensive chromatin remodeling that occurs as histones are replaced by protamines for compact DNA packaging in the sperm head.

What are the optimal methods for producing recombinant human SPATA25?

Production of recombinant human SPATA25 requires carefully designed experimental protocols to ensure proper protein folding and functionality. The following methodological approach is recommended:

  • Expression System Selection: For human SPATA25, mammalian expression systems (particularly HEK293 or CHO cells) are preferred over bacterial systems to ensure proper post-translational modifications. This is especially important if studying potential phosphorylation sites or glycosylation patterns that may regulate SPATA25 function.

  • Vector Design: The expression vector should contain:

    • Strong promoter (CMV for mammalian systems)

    • Kozak consensus sequence for efficient translation

    • Codon-optimized SPATA25 cDNA

    • Appropriate fusion tags (His6, FLAG, or GST) positioned to minimize interference with protein function

    • TEV protease cleavage site for tag removal

  • Purification Strategy: A multi-step purification protocol typically yields the best results:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Intermediate purification via ion exchange chromatography

    • Final polishing step using size exclusion chromatography

  • Quality Control Assessments:

    • SDS-PAGE for purity evaluation

    • Western blotting for identity confirmation

    • Circular dichroism to verify proper folding

    • Dynamic light scattering to assess aggregation state

    • Functional assays to confirm biological activity

When designing experiments with recombinant SPATA25, it's essential to include appropriate controls and reduce experimental variability through careful blocking of experimental units . This approach helps maximize statistical power and enables more precise detection of treatment effects when studying SPATA25 interactions with other molecular components .

How should researchers design experiments to investigate SPATA25 chemical interactions?

When investigating chemical interactions with SPATA25, researchers should implement the following experimental design principles:

  • Control for Confounding Variables: Design experiments that properly control for nuisance variables to reduce the risk of bias and prevent confounding effects . This is particularly important when studying SPATA25 interactions with chemicals known to have multiple cellular targets.

  • Blocking Design Implementation: Group similar experimental units together to reduce variability within each block, making treatment effects easier to detect . For SPATA25 studies, consider blocking by:

    • Cell passage number

    • Donor characteristics (for primary cells)

    • Batch of recombinant protein

    • Time of experiment

  • Concentration-Response Relationships: Design experiments that test multiple concentrations of test chemicals to establish dose-dependency. Based on previous studies, chemicals known to affect SPATA25 expression include:

ChemicalEffect on SPATA25Experimental ModelReference
17α-ethynylestradiolDecreased expressionRat modelPMID:37844793
2,3,7,8-tetrachlorodibenzodioxineDecreased expressionRat modelPMID:33387578
5-fluorouracilIncreased expressionHuman modelPMID:15331170
AcrylamideIncreased expressionRat modelPMID:28959563
Bisphenol ABoth increased and decreased expression (context-dependent)Rat modelPMID:25181051, PMID:34947998
Benzo[a]pyreneDecreased expression and affected methylationHuman modelPMID:32234424, PMID:27901495
  • Prevention of Pseudo-replication: Ensure that non-independent data points are not treated as independent, which could threaten the validity of experimental outcomes . This is particularly important in time-course studies of SPATA25 expression.

  • Statistical Analysis Planning: Plan statistical analyses before data collection to ensure appropriate data is collected and suitable methods are applied to address research questions .

What are the best techniques for studying SPATA25 function in human spermatogenesis?

To effectively study SPATA25 function in human spermatogenesis, researchers should employ a combination of complementary techniques:

  • Immunohistochemistry and Immunofluorescence:

    • Localize SPATA25 expression in different cell types within testicular tissue

    • Co-stain with markers of spermatogenic stages to determine temporal expression patterns

    • Use confocal microscopy for subcellular localization studies

  • Molecular Analysis Techniques:

    • RT-qPCR for quantitative expression analysis

    • Western blotting for protein level assessment

    • RNA-seq for transcriptome-wide effects of SPATA25 manipulation

    • ChIP-seq if SPATA25 has potential DNA-binding functionality

  • Functional Studies:

    • CRISPR-Cas9 gene editing to create SPATA25 knockouts or specific mutations

    • Overexpression studies using lentiviral vectors

    • Protein-protein interaction studies (co-immunoprecipitation, proximity ligation assay)

    • Metabolic analysis to assess effects on oxidative stress responses

  • Ex Vivo and In Vitro Models:

    • Testicular organoid culture systems

    • Primary Sertoli cell and germ cell co-cultures

    • Immortalized cell lines (with caution regarding physiological relevance)

When implementing these techniques, it's crucial to collect relevant data and mitigate experimental problems through careful planning . This should include strategies to address potential missing data and appropriate controls to ensure robust and informative results.

How are SPATA25 mutations associated with male infertility?

SPATA25 mutations may contribute to male infertility through disruption of normal spermatogenesis. Research indicates that genes regulating spermatogenesis, when subjected to loss-of-function mutations, can result in defective sperm production and functionality . While SPATA25 has not been explicitly identified as a causative gene for specific infertility syndromes in the provided search results, its role in spermatogenesis suggests potential involvement in unexplained male infertility cases.

The association between SPATA25 and infertility likely manifests through several mechanisms:

  • Disrupted Spermatogenic Progression: Mutations may interfere with the orderly progression of germ cells through spermatogenesis, potentially leading to maturation arrest.

  • Oxidative Stress Susceptibility: SPATA25 dysfunction might compromise cellular protection against reactive oxygen species, which are known to affect sperm count and DNA integrity . Testes are particularly vulnerable to oxidative damage due to their high content of unsaturated fatty acids and continuous cell proliferation .

  • Altered Sertoli Cell Interactions: Since normal spermatogenesis relies on interactions between developing germ cells and Sertoli cells, SPATA25 mutations could potentially disrupt this essential communication network .

  • Epigenetic Dysregulation: Chemicals like benzo[a]pyrene that affect SPATA25 methylation suggest that epigenetic regulation of this gene is important. Mutations affecting regulatory regions might therefore disrupt normal expression patterns.

When investigating SPATA25 in infertility cases, researchers should employ appropriate experimental designs that control for confounding variables and implement blocking strategies to reduce variability , enhancing the ability to detect true associations between genetic variants and clinical outcomes.

How does SPATA25 respond to environmental toxicants and what are the implications for reproductive health?

SPATA25 expression exhibits significant responsiveness to various environmental toxicants, suggesting potential implications for male reproductive health. Based on experimental evidence, SPATA25 shows differential responses to various chemicals:

Environmental ToxicantEffect on SPATA25Potential Reproductive ImplicationEvidence Quality
Bisphenol ABoth decreased and increased expression (context-dependent)Disruption of normal spermatogenesis patternsExperimental (EXP)
2,3,7,8-tetrachlorodibenzodioxineDecreased expressionPotential suppression of normal sperm developmentExperimental (EXP)
Benzo[a]pyreneDecreased expression and altered methylationEpigenetic disruption of spermatogenesisInferred from human studies (ISO)
AcrylamideIncreased expressionAltered cellular stress response during spermatogenesisExperimental (EXP)
Bis(2-ethylhexyl) phthalateDecreased expressionDisruption of normal testicular developmentInferred from mouse studies (ISO)

These chemical interactions suggest several important implications for reproductive health:

  • Environmental Exposure Assessment: The sensitivity of SPATA25 to multiple environmental chemicals indicates it could serve as a potential biomarker for reproductive toxicant exposure.

  • Epigenetic Vulnerability: The finding that benzo[a]pyrene and benzo[e]pyrene affect SPATA25 methylation suggests epigenetic regulation as a key mechanism through which environmental exposures might influence spermatogenesis over longer timeframes.

  • Contradictory Responses: The observation that bisphenol A can both increase and decrease SPATA25 expression highlights the complexity of these interactions and suggests dose, timing, or contextual factors may be critical in determining outcomes.

  • Cumulative Exposure Effects: The diversity of chemicals affecting SPATA25 raises questions about cumulative or synergistic effects of multiple toxicant exposures on spermatogenesis.

When designing studies to investigate these relationships, researchers should employ robust experimental designs that protect against confounding and minimize bias , particularly when examining complex dose-response relationships or time-dependent effects.

What role might SPATA25 play in rare genetic disorders affecting spermatogenesis?

While the search results don't specifically identify SPATA25 mutations as causative in rare genetic disorders, research indicates that numerous genes involved in spermatogenesis are associated with rare conditions affecting reproductive function . Based on our understanding of spermatogenesis-associated proteins, SPATA25 may potentially contribute to rare genetic disorders through several mechanisms:

  • Monogenic Inheritance Patterns: SPATA25 mutations could potentially contribute to monogenic forms of male infertility, particularly in cases characterized by specific spermatogenic defects without other systemic manifestations.

  • Polygenic Disease Contributions: SPATA25 might function as a modifier gene in more complex polygenic disorders affecting male reproduction, where multiple genetic factors contribute to disease manifestation.

  • Syndromic Associations: Based on the pattern observed with other spermatogenesis genes , SPATA25 dysfunction might be one component of broader syndromic disorders that include reproductive phenotypes alongside other systemic manifestations.

When investigating potential associations between SPATA25 and rare disorders, researchers should:

  • Implement careful patient phenotyping to identify specific spermatogenic defects

  • Consider ancestral background and population-specific variants

  • Examine potential gene-environment interactions, particularly given SPATA25's responsiveness to environmental chemicals

  • Design studies with appropriate statistical power to detect rare variants, applying principles of efficient experimental design

The identification of 22 distinct genes associated with 21 rare genetic conditions affecting spermatogenesis provides a framework for investigating whether SPATA25 plays a similar role in currently unexplained cases of rare reproductive disorders.

How should researchers analyze contradictory data regarding SPATA25 expression and function?

A methodological framework for resolving such contradictions includes:

  • Systematic Evaluation of Experimental Conditions:

    • Examine differences in cell types, tissue sources, and species used across studies

    • Compare dose ranges, exposure durations, and timing of measurements

    • Assess differences in detection methods and their sensitivity/specificity

    • Consider the developmental stage or cellular context of the experiments

  • Statistical Reanalysis Approaches:

    • Conduct meta-analyses when sufficient studies are available

    • Apply more sophisticated statistical models that can account for moderating variables

    • Consider Bayesian approaches that can incorporate prior knowledge and uncertainty

  • Experimental Design to Resolve Contradictions:

    • Design experiments specifically to test competing hypotheses

    • Include positive and negative controls to validate assay performance

    • Implement blocking strategies to reduce variability and increase power to detect true effects

    • Prevention of pseudo-replication to ensure statistical validity

  • Data Contradiction Analysis Framework:
    Similar to how researchers analyze contradictions in urban raster data , SPATA25 researchers can:

    • Identify "manifest contradictions" (directly observable in individual experiments)

    • Consider "hidden contradictions" that emerge only when comparing across studies

    • Model the probability of contradictory results based on experimental parameters

    • Evaluate whether contradictions represent true biological complexity rather than methodological artifacts

When analyzing apparently contradictory data, researchers should distinguish between true biological variability in SPATA25 function (which may reflect important regulatory mechanisms) and experimental artifacts that introduce spurious contradictions.

What novel methodologies are emerging for studying SPATA25 in reproductive biology?

Emerging methodologies for studying SPATA25 in reproductive biology leverage technological advances across multiple disciplines to provide deeper insights into its function and regulation:

  • Single-Cell Technologies:

    • Single-cell RNA sequencing to profile SPATA25 expression across the continuum of spermatogenesis

    • Spatial transcriptomics to preserve tissue context while examining expression patterns

    • CyTOF and spectral flow cytometry for multi-parameter protein analysis at the single-cell level

  • Advanced Genome Editing Approaches:

    • Base editing for precise nucleotide substitutions without double-strand breaks

    • Prime editing for targeted insertions, deletions, and all possible single-nucleotide variants

    • Inducible CRISPR systems for temporal control of SPATA25 manipulation

    • Epigenome editing to modify SPATA25 regulation without altering sequence

  • Organoid and Microphysiological Systems:

    • Advanced testicular organoids incorporating multiple cell types

    • Organ-on-chip platforms to model SPATA25 function in dynamic microenvironments

    • Bioprinting technologies to create spatially organized testicular tissue models

  • Computational and Systems Biology Approaches:

    • Network analysis to position SPATA25 within broader spermatogenesis regulation networks

    • Machine learning algorithms to predict SPATA25 interactions and functional outcomes

    • Multi-omics data integration to contextualize SPATA25 function

  • In Vivo Imaging Technologies:

    • SPATA25 reporter systems for real-time visualization in animal models

    • Multiphoton microscopy for deep tissue imaging with reduced phototoxicity

    • Expansion microscopy for super-resolution imaging of SPATA25 subcellular localization

When implementing these novel methodologies, researchers should apply principles of good experimental design , including clearly defined research objectives, appropriate control of confounding variables, and pre-planned statistical analyses to maximize the value extracted from these sophisticated approaches.

How can researchers integrate SPATA25 studies into broader investigations of male reproductive health?

Integrating SPATA25 research into broader investigations of male reproductive health requires strategic approaches that position this specific protein within larger biological contexts and translational frameworks:

  • Multi-Parameter Reproductive Health Assessments:

    • Correlate SPATA25 expression/function with standard semen parameters

    • Include SPATA25 analysis in broader male fertility biomarker panels

    • Assess relationships between SPATA25 variants and reproductive outcomes across populations

  • Environmental Health Research Integration:

    • Incorporate SPATA25 monitoring in environmental exposure studies

    • Develop SPATA25-based biomarkers for reproductive toxicant exposure

    • Evaluate how SPATA25 responses to chemicals like bisphenol A, tetrachlorodibenzodioxine, and benzo[a]pyrene relate to broader reproductive toxicity profiles

  • Clinical Research Applications:

    • Screen for SPATA25 mutations in unexplained male infertility cohorts

    • Evaluate SPATA25 as a potential diagnostic or prognostic marker for specific male fertility disorders

    • Consider therapeutic approaches targeting SPATA25 pathways

  • Comparative Biology Approaches:

    • Examine SPATA25 conservation and divergence across species

    • Use evolutionary analyses to identify functionally critical domains

    • Apply findings from model organisms to inform human reproductive health research

  • Interdisciplinary Research Frameworks:

    • Collaborate across fields (reproductive biology, toxicology, genetics, epigenetics)

    • Apply principles from systems biology to model SPATA25 within reproductive networks

    • Utilize translational research approaches to connect basic SPATA25 findings with clinical applications

When designing integrated research programs, investigators should apply robust experimental design principles , including:

  • Efficient resource allocation through blocking and randomization

  • Protection against confounding through appropriate controls

  • Prevention of pseudo-replication through careful statistical design

  • Collection of relevant data guided by clear research objectives

This integration allows SPATA25 research to contribute meaningfully to our understanding of male reproductive health while positioning findings within broader biological and clinical contexts.

What are the most significant unanswered questions about SPATA25?

Despite growing research on SPATA25, several critical questions remain unanswered:

  • Precise Molecular Function: While we know SPATA25 is associated with spermatogenesis, its exact molecular mechanisms and binding partners remain incompletely characterized. Understanding whether it functions as a structural protein, enzymatic component, or regulatory factor would significantly advance the field.

  • Temporal Expression Dynamics: The exact timing and regulation of SPATA25 expression throughout the spermatogenic cycle requires further elucidation, particularly regarding stage-specific functions during meiotic and post-meiotic development.

  • Genetic Variation Impact: The functional consequences of naturally occurring SPATA25 variants across human populations remain largely unexplored, particularly regarding their potential contributions to fertility differences.

  • Environmental Sensitivity Mechanisms: While multiple chemicals affect SPATA25 expression , the underlying mechanisms—whether through direct transcriptional regulation, epigenetic modifications, or post-transcriptional processes—require clarification.

  • Clinical Relevance: The relationship between SPATA25 dysfunction and specific male infertility phenotypes needs systematic investigation in well-characterized patient cohorts.

Addressing these questions will require integrative approaches combining molecular techniques, advanced imaging, genetic analyses, and carefully designed clinical studies. Researchers should apply robust experimental design principles to maximize the reliability and interpretability of findings in these complex investigations.

How might SPATA25 research evolve in the next decade?

SPATA25 research is poised for significant evolution over the next decade, driven by technological advances and shifting research paradigms:

  • Integration with Multi-Omics Approaches: Future research will likely integrate SPATA25 studies within broader multi-omics frameworks, examining how this protein functions within complex molecular networks controlling spermatogenesis.

  • Precision Medicine Applications: As our understanding deepens, SPATA25 variants may become important components of personalized reproductive health assessments, potentially guiding individualized fertility treatment approaches.

  • Environmental Health Biomarker Development: Given SPATA25's responsiveness to multiple environmental chemicals , it may emerge as a valuable biomarker for reproductive environmental health monitoring.

  • Therapeutic Target Exploration: Understanding SPATA25's role in spermatogenesis could potentially lead to novel therapeutic strategies for specific forms of male infertility or contraceptive development.

  • Computational Biology Acceleration: Advanced modeling approaches will increasingly complement experimental studies, predicting SPATA25 structure-function relationships and guiding hypothesis generation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.