Recombinant Human Sphingolipid delta (4)-desaturase/C4-hydroxylase DES2 (DEGS2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Sphingolipid delta(4)-desaturase/C4-hydroxylase DES2 (DEGS2)

Recombinant Human Sphingolipid delta(4)-desaturase/C4-hydroxylase DES2 (DEGS2) is a bifunctional enzyme that plays a crucial role in lipid metabolism by acting as both a sphingolipid delta(4)-desaturase and a sphingolipid C4-hydroxylase. This enzyme is part of the fatty acid desaturase family and is involved in the synthesis of ceramide and phytoceramide from dihydroceramide . The recombinant form of this enzyme is produced through various expression systems, including bacterial, yeast, and mammalian cells, to facilitate research and potential therapeutic applications.

Function and Role of DEGS2

DEGS2 is essential for maintaining the balance of sphingolipids in cells. It catalyzes the conversion of dihydroceramide into ceramide, a process critical for cell membrane structure and signaling pathways. Additionally, DEGS2 acts as a hydroxylase, converting dihydroceramide into phytoceramide, which is important for maintaining the integrity of the intestinal barrier . The dual functionality of DEGS2 highlights its significance in lipid metabolism and cellular homeostasis.

Expression and Production

Recombinant Human DEGS2 is produced using various expression systems to ensure high purity and activity. Common systems include:

  • E. coli: Known for high yield and ease of purification .

  • Yeast: Offers a more complex post-translational modification environment .

  • Mammalian Cells: Provides a more native environment for protein folding and modification .

  • Wheat Germ Expression System: Used for preserving correct protein conformation .

Research Findings

Recent studies have highlighted the role of DEGS2 in intestinal homeostasis and its potential involvement in inflammatory bowel disease. DEGS2-deficient models show a significant loss of phytoceramides and an accumulation of dihydroceramides, indicating its crucial role in maintaining sphingolipid balance . This research underscores the importance of DEGS2 in maintaining barrier function and suggests potential therapeutic targets for diseases related to sphingolipid metabolism.

Applications and Future Directions

The recombinant form of DEGS2 is used in various biochemical assays and research studies to understand its role in lipid metabolism and disease pathogenesis. Potential applications include:

  • Therapeutic Development: Targeting DEGS2 for treating diseases related to sphingolipid imbalance.

  • Basic Research: Studying the mechanisms of sphingolipid metabolism and its impact on cellular processes.

  • Diagnostic Tools: Developing assays to measure DEGS2 activity or sphingolipid profiles in clinical samples.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
DEGS2; C14orf66; Sphingolipid delta(4-desaturase/C4-monooxygenase DES2; Degenerative spermatocyte homolog 2; Sphingolipid 4-desaturase; Sphingolipid C4-monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-323
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
DEGS2
Target Protein Sequence
GNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWLV RGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPYA ASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKA VTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGHE TYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDFV FEDSLGPYARVKRVYRLAKDGL
Uniprot No.

Target Background

Function
Recombinant Human Sphingolipid delta(4)-desaturase/C4-hydroxylase DES2 (DEGS2) is a bifunctional enzyme exhibiting both sphingolipid delta(4)-desaturase and sphingolipid C4-monooxygenase activity.
Gene References Into Functions
  1. A genome-wide association study revealed a SNP significantly associated with cognitive function in schizophrenia. This SNP is also linked to DEGS2 expression regulation, suggesting a potential molecular mechanism for the clinical observation. PMID: 25871975
  2. DEGS1 or DEGS2 overexpression mitigates dihydroceramide accumulation and enhanced cell proliferation under hypoxic conditions. PMID: 21914808
  3. DES2 was identified and its upregulation observed during keratinocyte differentiation. PMID: 15063729
Database Links

HGNC: 20113

OMIM: 610862

KEGG: hsa:123099

STRING: 9606.ENSP00000307126

UniGene: Hs.159643

Protein Families
Fatty acid desaturase type 1 family, DEGS subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in skin, intestine and kidney.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.