Recombinant Human Sphingomyelin synthase-related protein 1 (SAMD8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
SAMD8; Sphingomyelin synthase-related protein 1; SMSr; Ceramide phosphoethanolamine synthase; CPE synthase; Sterile alpha motif domain-containing protein 8; SAM domain-containing protein 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-415
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SAMD8
Target Protein Sequence
MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIK VLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCD GPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDM QTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVF LLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSG HTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLF LYYHTLANTRAYQQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG
Uniprot No.

Target Background

Function
Sphingomyelin synthases synthesize sphingolipids by transferring a phosphatidyl head group to the primary hydroxyl of ceramide. SAMD8, an endoplasmic reticulum (ER) transferase, lacks sphingomyelin synthase activity but can convert phosphatidylethanolamine (PE) and ceramide to ceramide phosphoethanolamine (CPE), albeit with low product yield. It appears to function as a ceramide sensor to regulate ceramide homeostasis in the endoplasmic reticulum rather than a direct converter of ceramides. SAMD8 seems to be crucial for the integrity of the early secretory pathway.
Gene References Into Functions
  1. These findings highlight a role for SMSr as a negative regulator of ceramide-induced cell death. PMID: 28659495
  2. These results suggest a primary role for SMSr in monitoring endoplasmic reticulum ceramide levels. PMID: 24259670
Database Links

HGNC: 26320

OMIM: 611575

KEGG: hsa:142891

STRING: 9606.ENSP00000438042

UniGene: Hs.744986

Protein Families
Sphingomyelin synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SAMD8 in cellular lipid metabolism?

SAMD8 (Sphingomyelin synthase-related protein 1) primarily functions as a ceramide sensor in the endoplasmic reticulum (ER) rather than as an efficient lipid-converting enzyme. While it can catalyze the conversion of phosphatidylethanolamine (PE) and ceramide to ceramide phosphoethanolamine (CPE), it does so with notably low product yield. Its main biological role appears to be monitoring and maintaining ceramide homeostasis in the ER, which is crucial for cellular membrane integrity and function .

Unlike classical sphingomyelin synthases, SAMD8 lacks sphingomyelin synthase activity but shares structural similarities with this enzyme family. Its activity as a ceramide sensor makes it a critical component in cellular lipid homeostasis pathways, particularly within the early secretory pathway where it helps maintain appropriate lipid compositions for proper organelle function .

How does SAMD8 differ from other sphingomyelin synthase family members?

SAMD8 differs from other sphingomyelin synthase family members in several important ways:

  • Enzymatic activity: Unlike conventional sphingomyelin synthases that efficiently produce sphingomyelin, SAMD8 has no sphingomyelin synthase activity. Instead, it catalyzes the formation of ceramide phosphoethanolamine (CPE) from phosphatidylethanolamine and ceramide, albeit with low catalytic efficiency .

  • Subcellular localization: SAMD8 is specifically localized to the endoplasmic reticulum, while other sphingomyelin synthases may be found in different cellular compartments like the Golgi apparatus.

  • Physiological role: SAMD8 functions primarily as a ceramide sensor rather than as an efficient lipid-converting enzyme, suggesting it plays more of a regulatory role in lipid homeostasis than a direct biosynthetic function .

  • Impact on cellular function: SAMD8 appears to be particularly critical for maintaining the integrity of the early secretory pathway, potentially through its sensing of ceramide levels rather than through enzymatic production of specific lipids .

What tissues and cell types express significant levels of SAMD8?

While the search results don't provide comprehensive expression data, SAMD8 is known to be expressed in human tissues as evidenced by the availability of antibodies for human SAMD8 detection . As an ER protein involved in fundamental lipid homeostasis processes, SAMD8 is likely expressed across multiple tissue types, particularly those with high secretory activity or specialized membrane requirements.

The immunohistochemistry data for the anti-SAMD8 antibody indicates it is suitable for detecting SAMD8 in human tissue samples using paraffin-embedded sections (IHC-P) , suggesting expression in fixed human tissue specimens can be reliably detected with appropriate reagents.

How does SAMD8 regulate ceramide homeostasis in the endoplasmic reticulum?

SAMD8 functions as a specialized ceramide sensor in the endoplasmic reticulum, monitoring ceramide levels to maintain appropriate homeostasis. The mechanism likely involves:

  • Sensing capacity: SAMD8 appears to detect fluctuations in ceramide concentrations within the ER membrane environment .

  • Regulatory feedback: Upon detecting changes in ceramide levels, SAMD8 likely triggers regulatory responses that adjust ceramide metabolism, potentially through interactions with other enzymes in sphingolipid biosynthetic pathways.

  • Limited enzymatic activity: While SAMD8 possesses the ability to convert ceramide to ceramide phosphoethanolamine (CPE), this activity occurs with low efficiency and may serve as a mechanism to buffer excessive ceramide accumulation rather than as a primary metabolic pathway .

  • Membrane domain organization: By helping maintain specific lipid compositions, SAMD8 likely influences the formation and stability of specialized membrane domains within the ER that are critical for proper protein folding and trafficking.

This sensing function distinguishes SAMD8 from conventional enzymes and positions it as a regulatory component in the complex network of lipid homeostasis machinery within the cell .

What are the potential roles of SAMD8 in atherosclerosis and related cardiovascular diseases?

While the provided search results don't directly link SAMD8 to atherosclerosis, its function in lipid metabolism suggests potential relevance to cardiovascular disease pathophysiology:

  • Lipid homeostasis: As a regulator of ceramide metabolism, SAMD8 may influence cellular lipid homeostasis, which is critical in atherosclerosis development where lipid accumulation and metabolism are key pathogenic factors .

  • Membrane environment regulation: SAMD8 plays a role in "synthesizing and maintaining specific lipid environments in membranes impacting cellular signaling" , which could affect cellular processes relevant to atherosclerotic plaque formation and progression.

  • Potential genetic associations: Given the identification of novel pleiotropic loci in genome-wide association studies of atherosclerosis , SAMD8 genetic variants might contribute to disease susceptibility through effects on lipid metabolism.

  • Secretory pathway integrity: SAMD8's critical role in maintaining early secretory pathway integrity could impact various cellular functions relevant to vascular health, including protein trafficking and secretion of inflammatory mediators.

While specific research findings directly connecting SAMD8 to atherosclerosis are not provided in the search results, these mechanistic connections suggest potential avenues for investigation in cardiovascular disease contexts.

How do mutations in SAMD8 affect cellular ceramide levels and downstream signaling pathways?

Mutations in SAMD8 would likely disrupt its ceramide sensing function in the endoplasmic reticulum, potentially leading to:

  • Dysregulated ceramide homeostasis: Loss of SAMD8 function would impair the cell's ability to monitor and regulate ceramide levels, potentially leading to ceramide accumulation in the ER membrane .

  • ER stress responses: Abnormal ceramide levels could trigger ER stress pathways, as proper lipid composition is essential for ER function.

  • Altered membrane properties: Changes in ceramide levels would modify membrane biophysical properties, potentially affecting the function of membrane-embedded proteins and signaling complexes .

  • Compromised secretory pathway: Given that SAMD8 is "critical for the integrity of the early secretory pathway" , mutations would likely impair protein trafficking through the ER-Golgi system.

  • Modified cellular signaling: Since SAMD8 impacts "cellular signaling and the movement of membrane constituents" , mutations could have broad effects on various cellular signaling networks that depend on proper membrane organization.

Research examining these effects would require genetic manipulation models (knockout or point mutations) combined with lipid profiling and cellular phenotyping approaches.

What techniques can be used to quantify SAMD8 enzymatic activity in vitro?

To quantify SAMD8 enzymatic activity in vitro, researchers can employ several complementary approaches:

  • Radiolabeled substrate assays: Using ceramide and phosphatidylethanolamine substrates with radioactive labels (typically 14C or 3H) to track the formation of ceramide phosphoethanolamine (CPE).

  • Mass spectrometry-based approaches: Liquid chromatography coupled to mass spectrometry (LC-MS) can be used to directly measure the conversion of substrates to products with high sensitivity and specificity.

  • Fluorescent substrate analogs: Modified substrates containing fluorescent moieties can allow for real-time monitoring of enzymatic activity through changes in fluorescence properties.

  • Recombinant protein expression systems: For in vitro activity assays, SAMD8 should be expressed and purified from suitable expression systems (bacterial, insect, or mammalian cells) while maintaining proper folding and membrane association.

  • Liposome-based assays: Since SAMD8 is a membrane protein, reconstitution into artificial membrane systems (liposomes) with defined lipid compositions can provide a controlled environment for activity measurements.

Given SAMD8's low catalytic efficiency for CPE production , assay conditions must be carefully optimized to detect activity above background levels, potentially requiring extended incubation times or higher enzyme concentrations than typically used for more active enzymes.

What is the optimal experimental design for studying SAMD8's role as a ceramide sensor?

An optimal experimental design for investigating SAMD8's ceramide sensing function would incorporate multiple complementary approaches:

  • Structural biology approaches:

    • Protein crystallography or cryo-EM to determine SAMD8's three-dimensional structure

    • Identification of potential ceramide binding domains through computational modeling

    • Site-directed mutagenesis of putative sensing domains to validate their function

  • Live-cell ceramide monitoring:

    • FRET-based biosensors to detect ceramide-SAMD8 interactions in living cells

    • Photoactivatable ceramide analogs to track dynamic interactions

    • Correlative microscopy approaches combining fluorescence and electron microscopy

  • Cellular response systems:

    • CRISPR-modified cell lines with SAMD8 mutations or deletions

    • Inducible expression systems to control SAMD8 levels

    • Controlled manipulation of cellular ceramide levels via enzyme inhibitors or exogenous ceramide delivery

  • Biochemical interaction studies:

    • Surface plasmon resonance (SPR) or microscale thermophoresis to measure direct binding between purified SAMD8 and ceramide species

    • Pull-down assays with ceramide-conjugated matrices

    • Thermal shift assays to detect stabilization of SAMD8 upon ceramide binding

  • Genetic approaches:

    • Tissue-specific or inducible knockout models to examine physiological consequences

    • Rescue experiments with mutant forms of SAMD8 lacking sensor function

These approaches should be integrated to build a comprehensive understanding of how SAMD8 detects ceramide levels and translates this information into cellular responses affecting lipid homeostasis .

How can one distinguish between SAMD8's enzymatic and sensing functions in cellular models?

Distinguishing between SAMD8's enzymatic activity (converting PE and ceramide to CPE) and its sensing function requires careful experimental design:

This experimental strategy would enable researchers to parse the relative contributions of SAMD8's dual functions to cellular ceramide homeostasis and secretory pathway integrity .

How might SAMD8 function be targeted for therapeutic intervention in diseases related to ceramide dysregulation?

Targeting SAMD8 function for therapeutic purposes requires understanding the specific disease contexts where ceramide sensing and homeostasis contribute to pathology:

  • Small molecule approaches:

    • Develop compounds that modulate SAMD8's sensing capacity without affecting structural integrity

    • Design competitive inhibitors that occupy the ceramide binding site but don't trigger downstream responses

    • Create allosteric modulators that enhance or diminish sensing sensitivity in contexts of deficient or excessive sensing

  • Gene therapy strategies:

    • For conditions with insufficient SAMD8 function, targeted gene delivery to relevant tissues

    • For contexts where enhanced sensing would be beneficial, expression of engineered SAMD8 variants with improved sensing properties

  • Targeted degradation approaches:

    • Proteolysis-targeting chimeras (PROTACs) or related technologies to selectively reduce SAMD8 levels in disease contexts where its activity contributes to pathology

    • Tissue-specific targeting to limit systemic effects

  • Metabolic intervention:

    • Modulate upstream ceramide production pathways to compensate for SAMD8 dysfunction

    • Target parallel sensors or regulators that might provide redundancy to SAMD8 function

  • Biomarker development:

    • Establish ceramide profiles associated with SAMD8 dysfunction for patient stratification

    • Monitor therapeutic responses through changes in specific ceramide species levels

These approaches would need to account for SAMD8's critical role in maintaining the integrity of the early secretory pathway , ensuring that interventions don't disrupt essential cellular functions.

What experimental systems best model the physiological context of SAMD8 function?

To properly model SAMD8's physiological function, experimental systems should recapitulate key aspects of its cellular environment:

  • Membrane models:

    • Lipid compositions mimicking the ER membrane where SAMD8 naturally functions

    • Reconstitution into artificial membrane systems with physiologically relevant curvature and dynamics

    • Incorporation of other ER proteins that might modulate SAMD8 function

  • Cellular systems:

    • Cell types with well-characterized sphingolipid metabolism

    • Primary cells rather than transformed lines when studying physiological responses

    • Three-dimensional culture systems that preserve tissue architecture and cell polarity

    • Co-culture systems incorporating multiple cell types that communicate through sphingolipid mediators

  • Animal models:

    • Conditional and tissue-specific knockout models to avoid developmental confounders

    • Knockin models expressing tagged versions of SAMD8 for in vivo localization and interaction studies

    • Humanized models expressing human SAMD8 variants to study disease-associated polymorphisms

  • Human-derived systems:

    • Patient-derived cells harboring natural SAMD8 variants

    • Induced pluripotent stem cells differentiated into relevant lineages

    • Organoid cultures that recapitulate tissue-specific environments

  • Dynamic perturbation approaches:

    • Systems allowing acute manipulation of ceramide levels or SAMD8 activity

    • Models incorporating physiological stressors known to affect ceramide metabolism

These systems should enable researchers to investigate SAMD8's role in synthesizing and maintaining specific lipid environments that impact cellular signaling and membrane constituent movement .

What are the current knowledge gaps in SAMD8 biology that require further research?

Despite our understanding of SAMD8's basic function, significant knowledge gaps remain that warrant dedicated research efforts:

  • Structural determinants of ceramide sensing: The precise molecular mechanisms by which SAMD8 detects ceramide levels remain unclear, including specific binding domains and conformational changes induced by ceramide association.

  • Downstream signaling pathways: How ceramide sensing by SAMD8 is translated into cellular responses affecting lipid metabolism and membrane organization requires further characterization.

  • Tissue-specific functions: The relative importance of SAMD8 in different tissues and cell types, especially those with specialized membrane requirements, remains to be fully elucidated.

  • Relationship to disease pathophysiology: While SAMD8 functions in lipid metabolism suggest potential roles in diseases characterized by lipid dysregulation (including atherosclerosis), direct evidence linking SAMD8 to specific pathologies is limited.

  • Interaction networks: The proteins and lipids that interact with SAMD8 to coordinate ceramide homeostasis and membrane organization need more comprehensive mapping.

  • Evolutionary conservation: How SAMD8 function has evolved across species and whether this reflects adaptation to different membrane composition requirements remains unexplored.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.