Recombinant Human Sphingosine-1-phosphate lyase 1 (SGPL1)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Production

Recombinant SGPL1 is a truncated 59–568 amino acid fragment of the full-length human protein, expressed in Sf9 insect cells via baculovirus-mediated transduction. Key characteristics include:

PropertyValueSource
Molecular Weight60–63 kDa
Expression SystemBaculovirus-infected Sf9 cells
Purity≥90%
Catalytic ActivityCleaves S1P into phosphoethanolamine and hexadecanal

The enzyme belongs to the group II decarboxylase family and contains a vitamin B6 (pyridoxal 5′-phosphate, PLP)-binding site essential for catalysis . Its cytoplasmic domain (aa 62–568) mediates irreversible S1P degradation, a process critical for regulating sphingolipid homeostasis .

Functional Roles in Cellular Biology

SGPL1 modulates sphingolipid signaling, apoptosis, and cellular stress responses:

Core Functions

  1. Sphingolipid Metabolism

    • Irreversible S1P Degradation: Prevents S1P accumulation, which otherwise promotes cancer progression, chemo-resistance, and inflammation .

    • Ceramide Production: Enhances stress-induced ceramide synthesis, driving apoptosis under cellular stress .

  2. Tissue-Specific Roles

    TissueFunctionSource
    LiverGlobal lipid homeostasis
    NeuronsAutophagy regulation via phosphoethanolamine
    GonadsGerm cell development (inhibition of S1P-mediated NPR2 inactivation)
  3. Cancer Biology

    • Tumor Suppression: Overexpression reduces cancer cell migration and colony formation in rhabdomyosarcoma and breast cancer models .

    • Chemo-Sensitivity: Restores sensitivity to platinum-based therapies by mitigating S1P-driven survival signaling .

Research Applications

Recombinant SGPL1 enables precise investigation of sphingolipid dynamics and disease mechanisms:

Experimental Uses

ApplicationFindingsSource
Cancer Migration StudiesSGPL1 overexpression reduces S1P-induced migration in rhabdomyosarcoma (RH-30) and breast cancer (MCF-7) cells .
Germ Cell DevelopmentSgpl1 deletion in mice causes infertility due to S1P accumulation inhibiting NPR2 activity and Leydig cell apoptosis .
Mitochondrial DynamicsSGPL1 deficiency alters oxidative phosphorylation and mitochondrial morphology in fibroblasts .

Cancer Progression

  • Pediatric Rhabdomyosarcoma: SGPL1 mislocalization and a G321A mutation impair S1P degradation, enhancing invasion and chemo-resistance . Restoring SGPL1 activity reduces colony formation by ~70% .

  • Breast Cancer: Low SGPL1 expression correlates with poor prognosis. Overexpression suppresses migration in BT-20 cells and restores ER localization .

Germ Cell Development

  • Ovarian Follicles: S1P accumulation in Sgpl1 knockout mice inhibits NPR2 activity, arresting follicular growth .

  • Testicular Spermatogenesis: S1P-induced Leydig cell apoptosis and p21 upregulation block spermatocyte maturation .

Metabolic Regulation

  • Steroidogenesis: SGPL1 deficiency impairs acute steroid production in dermal fibroblasts .

  • Lipid Homeostasis: Required for cholesterol regulation in fibroblasts and global lipid balance in the liver .

Localization and Activity

  • Endoplasmic Reticulum (ER) Anchoring: Proper localization to the ER membrane ensures efficient S1P degradation. Mutations (e.g., G321A) disrupt this localization, reducing catalytic efficiency .

  • Catalytic Mechanism: PLP-dependent cleavage of S1P generates non-sphingolipid metabolites, terminating signaling .

Clinical Relevance

  • Cancer Therapeutics: Targeting SGPL1 activity may enhance chemotherapy efficacy by mitigating S1P-mediated survival pathways .

  • Infertility Treatments: Restoring SGPL1 function could address S1P-driven germ cell development defects .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
SGPL1; KIAA1252; Sphingosine-1-phosphate lyase 1; S1PL; SP-lyase 1; SPL 1; hSPL; Sphingosine-1-phosphate aldolase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-568
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH
Uniprot No.

Target Background

Function
Sphingosine-1-phosphate lyase 1 (SGPL1) is an enzyme that cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. This activity elevates stress-induced ceramide production and apoptosis. SGPL1 is essential for global lipid homeostasis in the liver and cholesterol homeostasis in fibroblasts. It plays a role in regulating the pro-inflammatory response and neutrophil trafficking. Furthermore, SGPL1 modulates neuronal autophagy through phosphoethanolamine production, which regulates the accumulation of aggregate-prone proteins such as amyloid precursor protein (APP). This enzyme appears to be involved in establishing neuronal contact sites and maintaining axonal integrity.
Gene References Into Functions
  1. This study describes the sequential expression and localization of the endogenous S1P regulators SGPP-1 and SGPL-1, highlighting their contribution to the sphingolipid rheostat in inflammation. PMID: 29375197
  2. This research verifies the role of a high-ranked gene in the dysregulation of sphingolipid metabolism in Huntington's disease and demonstrates that inhibiting the enzyme, sphingosine-1-phosphate lyase 1 (SPL), has neuroprotective effects in Huntington's disease models. PMID: 28931805
  3. Loss of SGPL1 function is associated with congenital nephrotic syndrome (CNS), adrenal calcifications, and hypogonadism. PMID: 28181337
  4. These results demonstrate that Sphingosine 1-phosphate lyase (SPL) is a host factor that augments type I IFN responses during influenza A virus infection. This study delineates the relationship between IKKepsilon and SPL, providing a mechanistic understanding of the pro-IFN activity of SPL. PMID: 28600291
  5. Mutations in sphingosine-1-phosphate lyase cause nephrosis with ichthyosis and adrenal insufficiency. PMID: 28165339
  6. Sphingosine-1-phosphate lyase mutations cause primary adrenal insufficiency and steroid-resistant nephrotic syndrome. PMID: 28165343
  7. Overexpression of sphingosine-1-phosphate lyase 1 (SGPL1) reverses the interleukin-8 (IL-8) secretion enhancing effect of microRNA miR-125b in trophoblast cell line HTR8/SVneo cells. PMID: 27935985
  8. This study reports a candidate gene (SGPL1) for autosomal recessive Charcot-Marie-Tooth disease with an atypical disease course. Studies in patient-derived biosamples suggest that this phenotype is due to partial loss of SGPL1 function. Neuron-specific downregulation of the Drosophila orthologue impaired the morphology of the neuromuscular junction and caused progressive neurodegeneration. PMID: 28077491
  9. The SPHK1:SGPL1 ratio correlated with increased cellular sphingosine-1-phosphate (S1P), and S1P correlated with drug resistance (IC50). PMID: 26493335
  10. Results show that dissociation of SHP-1 from spinophilin is followed by an increase in the binding of spinophilin to PP1. PMID: 25785436
  11. Sphingosine-1-phosphate lyase downregulation promotes colon carcinogenesis through STAT3-activated microRNAs. PMID: 25347472
  12. S1P lyase, by facilitating S1P1 receptor recycling, is essential for S1P-mediated sustained signaling. PMID: 24704119
  13. These results highlight the importance of S1P in Alzheimer's disease, suggesting the existence of a global deregulation of S1P signaling in this disease from its synthesis by SphK1 and degradation by SPL to its signaling by the S1P1 receptor. PMID: 24468113
  14. The cells expressing SGPL1 in the parenchyma were CD68(+) APCs. PMID: 24825162
  15. Data show that an easy assay for 2-hydroxyacyl-CoA lyase (HACL1) and sphingosine-1-phosphate lyase (SGPL1) activities was developed. PMID: 24323699
  16. SPL expression and activity are downregulated in cancerous tissues, and there is a relationship between loss of SPL expression and prostate cancer aggressiveness. PMID: 22784711
  17. S1P(ext) mediated endothelial cell motility is dependent on intracellular S1P production, which is regulated, in part, by SphK1 and S1PL. PMID: 21304987
  18. S1P lyase regulates DNA damage responses through a sphingolipid feedback mechanism. PMID: 21368890
  19. High SPL transcription of H1155 cells was regulated by Sp1 and GATA-4/Sp1 complex formation, both of which bind to Sp1 sites of the 5'-SPL promoter. PMID: 21184844
  20. Overexpression of sphingosine 1-phosphate lyase (SPL), which induces the degradation of sphingosine 1-phosphate, interfered with the amplification of infectious influenza virus. PMID: 20519401
  21. Sphingosine-1-phosphate lyase is a dual modulator of sphingosine 1-phosphate and ceramide metabolism as well as a regulator of cell fate decisions. PMID: 14570870
  22. Genetic or epigenetic changes affecting intestinal sphingosine-1-phosphate metabolism may correlate with and potentially contribute to carcinogenesis. PMID: 17090686
  23. Extracellular S1P is dephosphorylated and subsequently converted by cells, which appears to be important for clearance of the signaling molecule S1P in the local tissue environment after infections or injuries. PMID: 18172856
  24. Data suggest that lymphocyte trafficking is particularly sensitive to variations in sphingosine 1-phosphate lyase (S1PL) activity and suggest that there is a window in which partial inhibition of S1PL could produce therapeutic levels of immunosuppression. PMID: 19119317

Show More

Hide All

Database Links

HGNC: 10817

OMIM: 603729

KEGG: hsa:8879

STRING: 9606.ENSP00000362298

UniGene: Hs.499984

Involvement In Disease
Nephrotic syndrome 14 (NPHS14)
Protein Families
Group II decarboxylase family, Sphingosine-1-phosphate lyase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type III membrane protein; Cytoplasmic side.
Tissue Specificity
Ubiquitously expressed. Expressed in fetal and adult adrenal gland (at protein level).

Q&A

What is the primary function of SGPL1 in cellular metabolism?

SGPL1 functions as a highly conserved enzyme that irreversibly degrades sphingosine-1-phosphate (S1P), a bioactive lipid mediator involved in numerous cellular processes. Mechanistically, SGPL1 cleaves phosphorylated sphingoid bases into fatty aldehydes and phosphoethanolamine, representing a critical step in sphingolipid metabolism . This degradation pathway serves as the only exit route for sphingolipid intermediates from the sphingolipid metabolic cycle, making SGPL1 a key regulator of cellular S1P levels. The enzyme operates primarily as a homodimer and is expressed in various tissues including reproductive organs, where it exhibits tissue-specific expression patterns in granulosa cells, Leydig cells, spermatocytes, and round spermatids .

How does SGPL1 contribute to normal gonadal development?

SGPL1 plays an essential role in reproductive tissue development by regulating intracellular S1P concentration. In normal ovarian development, SGPL1 maintains appropriate S1P levels, which prevents interference with natriuretic peptide receptor 2 (NPR2) activity in granulosa cells. This regulation is crucial for early follicle growth and proper oocyte development . In testicular tissue, SGPL1 prevents excessive S1P accumulation, which would otherwise increase cyclin-dependent kinase inhibitor 1A (p21) expression and promote apoptosis in Leydig cells. Studies of SGPL1-knockout mice demonstrate that deletion of this enzyme results in infertility due to failure of germ cell development in both sexes, though through different signaling pathways .

What are the known tissue expression patterns of SGPL1?

SGPL1 exhibits differential expression across various tissue types, with particularly significant presence in reproductive organs. Research demonstrates that SGPL1 is predominantly expressed in granulosa cells and Leydig cells within ovarian and testicular tissues, respectively . Additionally, within the male reproductive system, SGPL1 expression has been documented in spermatocytes and round spermatids. The enzyme has also been identified in adrenal tissue, where its dysfunction has been linked to primary adrenal insufficiency . This tissue-specific expression pattern correlates with the phenotypic manifestations observed in SGPL1-deficient models, particularly regarding reproductive and adrenal function. Understanding these expression patterns is essential for interpreting experimental results when studying SGPL1 in different physiological contexts.

What phenotypes result from SGPL1 knockout in mouse models?

SGPL1 knockout in mouse models produces multi-systemic effects with particularly pronounced reproductive consequences. The most striking phenotype is complete infertility in both male and female knockout mice, resulting from arrested germ cell development . In female knockout mice, follicular development is impaired due to S1P accumulation, which suppresses NPR2 activity in granulosa cells, inhibiting early follicle growth. Male knockout mice exhibit spermatogenesis arrest, with histological analysis revealing increased S1P levels that elevate p21 expression and trigger apoptosis in Leydig cells . These animals may also display adrenal insufficiency similar to that seen in human SGPL1 mutations. Researchers working with these models should note that the phenotypic effects manifest through different molecular pathways in males versus females, despite the common endpoint of reproductive failure.

How can researchers effectively measure SGPL1 activity in experimental samples?

For accurate measurement of SGPL1 activity in experimental samples, researchers should employ a multi-faceted approach. ELISA-based methods offer a sensitive technique for quantifying SGPL1 protein levels in serum, plasma, and cell culture supernatants, with detection ranges typically between 78-5000 pg/mL and sensitivity thresholds around 36 pg/ml . For functional activity assays, researchers can utilize substrates labeled with fluorescent or radioactive markers to measure the conversion of S1P to hexadecenal and phosphoethanolamine. When designing experimental protocols, attention should be paid to sample preparation – tissue homogenates require careful handling to preserve enzymatic activity, while cell culture experiments benefit from controlled expression systems. Validation should include positive and negative controls, particularly SGPL1-knockout tissues or cells treated with known SGPL1 inhibitors, to confirm assay specificity.

What are the most effective ways to modulate SGPL1 function in cell culture experiments?

For effective modulation of SGPL1 function in cell culture experiments, researchers should consider multiple complementary approaches. Genetic manipulation techniques including CRISPR-Cas9 gene editing provide precise control for creating SGPL1 knockout or knockin cell lines. For transient modulation, siRNA or shRNA techniques achieve temporary SGPL1 knockdown with approximately 70-90% efficiency depending on cell type and transfection protocol. Expression vectors carrying wild-type or mutant SGPL1 variants enable overexpression studies or rescue experiments. Pharmacological approaches provide an alternative strategy, though specific SGPL1 inhibitors remain limited. When conducting these experiments, researchers should verify modulation efficiency through protein quantification (Western blot or ELISA) and functional assays measuring S1P accumulation or degradation rates. Cell-type specific considerations are crucial since SGPL1 expression levels vary significantly between different tissues, potentially affecting baseline activity and experimental outcomes .

How do SGPL1 mutations contribute to primary adrenal insufficiency?

SGPL1 mutations contribute to primary adrenal insufficiency (PAI) through disruption of sphingolipid metabolism, leading to S1P accumulation and subsequent adrenal dysfunction. Research has identified SGPL1 mutations as the causative factor in steroid-resistant nephrotic syndrome type 14 (NPHS14), which features PAI as a key manifestation . The mechanism involves impaired glucocorticoid production, potentially through altered ACTH signaling or direct effects on steroidogenic pathways. A significant case study involved a patient with a homozygous c.665G>A (p.R222Q) SGPL1 variant who presented with hypoglycemia and seizures at age 2, ultimately diagnosed with isolated glucocorticoid deficiency . Clinically, patients may present with symptoms typical of adrenal crisis, including hypoglycemia, hypotension, and electrolyte abnormalities. Importantly, SGPL1-related PAI may initially present without other manifestations of NPHS14, suggesting that adrenal dysfunction can precede kidney disease in the temporal sequence of this disorder .

What is the relationship between SGPL1 deficiency and steroid-resistant nephrotic syndrome?

SGPL1 deficiency has been established as the causative factor in steroid-resistant nephrotic syndrome type 14 (NPHS14), a complex sphingolipidosis with multi-system manifestations. The pathophysiological mechanism involves disruption of sphingolipid homeostasis within podocytes and other kidney cells, leading to proteinuria resistant to standard steroid therapy . Research indicates that S1P accumulation alters glomerular filtration barrier integrity through effects on cytoskeletal organization and cell signaling pathways. Clinical presentation typically includes proteinuria, hypoalbuminemia, and edema, with progression to end-stage renal disease in many cases. Genetic studies have identified various SGPL1 mutations in affected individuals, with both homozygous and compound heterozygous patterns reported. Notably, some patients with SGPL1 mutations may initially present with isolated primary adrenal insufficiency before developing nephrotic manifestations, suggesting a temporal evolution of the clinical phenotype . This relationship highlights the importance of considering SGPL1 mutations in the differential diagnosis of patients with steroid-resistant nephrotic syndrome, particularly when accompanied by adrenal insufficiency.

How should researchers approach genetic screening for SGPL1 mutations in clinical samples?

When screening for SGPL1 mutations in clinical samples, researchers should implement a comprehensive sequencing strategy that accounts for the gene's structure and known pathogenic variants. The SGPL1 gene (10q22.1) contains multiple exons requiring complete coverage through specific PCR amplification using primer sets spanning the entire coding region . A methodical approach involves:

  • DNA extraction from peripheral blood leukocytes using standardized protocols (e.g., Maxwell 16 Blood DNA Purification Kit)

  • PCR amplification with approximately 14 primer sets designed to cover all exons and exon-intron boundaries

  • Bidirectional sequencing of purified PCR products

  • Bioinformatic analysis comparing results against reference sequences and variant databases

When interpreting results, researchers should consider both previously reported pathogenic variants and novel variations. Statistical analysis comparing identified variants against population databases (e.g., ExAC, gnomAD) is essential for determining significance . For novel variants, in silico prediction tools can help assess potential pathogenicity. Importantly, screening should not be limited to patients with the complete NPHS14 phenotype, as some patients may present with isolated primary adrenal insufficiency before developing other manifestations.

What are the optimal techniques for recombinant SGPL1 production and purification?

For optimal recombinant SGPL1 production and purification, researchers should implement a strategic approach utilizing eukaryotic expression systems. Human embryonic kidney (HEK293) or Chinese hamster ovary (CHO) cell lines are preferable to bacterial systems due to SGPL1's requirement for proper post-translational modifications. Expression constructs should include the full-length human SGPL1 cDNA (corresponding to UniProt entry O95470) with an affinity tag (His6 or FLAG) positioned to avoid interference with the catalytic site .

For protein expression, stable transfection yields more consistent results than transient approaches, with typical expression levels ranging between 1-5 mg/L in optimized systems. The purification protocol should follow a multi-step process: initial capture using affinity chromatography (Ni-NTA for His-tagged constructs), followed by ion-exchange chromatography to remove contaminants, and finally size-exclusion chromatography to isolate the active homodimeric form of SGPL1 .

Critical quality control steps include SDS-PAGE analysis, Western blotting, and enzymatic activity assays measuring the conversion of S1P to hexadecenal. Researchers should verify that recombinant SGPL1 maintains its homodimeric structure and exhibits enzymatic activity comparable to native protein before using it in downstream applications.

How can researchers effectively study SGPL1-protein interactions and signaling pathways?

To effectively study SGPL1-protein interactions and associated signaling pathways, researchers should employ multiple complementary approaches. Co-immunoprecipitation (Co-IP) experiments combined with mass spectrometry represent a powerful strategy for identifying novel SGPL1-interacting proteins, particularly when conducted under physiologically relevant conditions. For visualizing protein interactions in cellular contexts, proximity ligation assays (PLA) or fluorescence resonance energy transfer (FRET) techniques provide spatial information about interaction dynamics.

When investigating signaling pathways, phosphoproteomic analysis following SGPL1 modulation can reveal downstream effectors affected by altered S1P levels. Specifically for SGPL1's effects on reproductive tissues, measurement of NPR2 guanylyl cyclase activity in granulosa cells and quantification of p21 expression and apoptotic markers in Leydig cells are essential parameters based on established pathways . Researchers should design time-course experiments to capture both immediate and delayed signaling events, as S1P acts as both a first and second messenger. Cross-validation of identified interactions through multiple techniques is crucial given the complexity of sphingolipid signaling networks and potential for experimental artifacts.

What cellular imaging techniques best capture SGPL1 subcellular localization and trafficking?

For optimal visualization of SGPL1 subcellular localization and trafficking, researchers should employ advanced fluorescent microscopy techniques combined with appropriate cellular markers. Confocal microscopy represents the standard approach, using either fluorescently-tagged SGPL1 constructs (ensuring tags do not disrupt localization signals) or immunofluorescence with validated anti-SGPL1 antibodies. Co-staining with organelle markers is essential, particularly for endoplasmic reticulum (ER) components, as SGPL1 predominantly localizes to the ER membrane.

For dynamic trafficking studies, live-cell imaging using photoactivatable or photoconvertible SGPL1 fusion proteins allows temporal tracking of protein movement. Super-resolution techniques including Stimulated Emission Depletion (STED) or Stochastic Optical Reconstruction Microscopy (STORM) provide resolution below 50 nm, enabling precise visualization of SGPL1 distribution within membrane microdomains. To validate localization patterns, researchers should complement imaging with subcellular fractionation followed by Western blotting or enzymatic activity assays of isolated fractions.

When studying tissue samples, particularly from reproductive organs where SGPL1 shows specific expression patterns in granulosa cells, Leydig cells, spermatocytes, and round spermatids, immunohistochemistry with chromogenic or fluorescent detection provides valuable contextual information about cell-type specific expression .

How should researchers interpret contradictory findings in SGPL1 research?

When confronting contradictory findings in SGPL1 research, investigators should implement a systematic analytical framework. First, examine methodological differences between studies, particularly regarding experimental models (cell lines versus primary cells, species differences), SGPL1 quantification techniques (protein levels versus enzymatic activity), and S1P measurement approaches. The tissue-specific expression patterns of SGPL1 in granulosa cells, Leydig cells, spermatocytes, and round spermatids suggest that results may vary significantly depending on the cellular context .

Second, consider the dichotomous effects of SGPL1 deletion in male versus female reproductive tissues – S1P accumulation affects NPR2 activity in female gonads but impacts p21 levels and apoptosis in male tissues . This mechanistic divergence might explain seemingly contradictory outcomes in different experimental systems.

Third, evaluate genetic variations in experimental models, as different SGPL1 mutations may produce varying phenotypic severity. The homozygous c.665G>A (p.R222Q) variant, for instance, presents with isolated glucocorticoid deficiency before developing other manifestations of NPHS14 .

Finally, rigorously assess statistical approaches, sample sizes, and reporting practices. When integrating contradictory findings, researchers should prioritize results from multiple independent laboratories using diverse methodologies over isolated observations.

What statistical approaches are most appropriate for analyzing SGPL1 expression data in clinical samples?

For analyzing SGPL1 expression data in clinical samples, researchers should implement statistical approaches that address both the biological complexity and technical limitations of such datasets. When comparing SGPL1 expression between patient groups (e.g., those with and without adrenal insufficiency), non-parametric tests like Mann-Whitney U or Kruskal-Wallis are often more appropriate than parametric tests, as biological expression data frequently violates normality assumptions.

For mutation analysis studies, statistical comparison between the frequency of identified variants in patient cohorts versus population databases (e.g., ExAC, gnomAD) should employ chi-square testing to determine significance . When analyzing correlations between SGPL1 expression/activity and clinical parameters, Spearman's rank correlation provides robust results less affected by outliers than Pearson's correlation.

Power analysis is essential when designing studies, with sample size calculations based on expected effect sizes derived from preliminary data. For complex datasets with multiple variables, multivariate regression models can help identify independent associations between SGPL1 variants/expression levels and clinical outcomes while controlling for confounding factors. When analyzing genetic associations, correction for multiple testing (e.g., Bonferroni or false discovery rate methods) is critical to minimize type I errors. Finally, researchers should report confidence intervals alongside p-values to provide insight into effect size magnitude and precision.

How can researchers effectively correlate SGPL1 function with physiological outcomes in complex systems?

To effectively correlate SGPL1 function with physiological outcomes in complex systems, researchers should implement an integrated multi-omics approach. Begin by establishing clear mechanistic hypotheses based on SGPL1's role in sphingolipid metabolism and known signaling pathways affected by S1P fluctuations. In reproductive tissues, for example, distinct measurement parameters include NPR2 activity in granulosa cells for female systems and p21 expression/apoptotic markers in Leydig cells for male systems .

A comprehensive correlation strategy should combine:

  • Sphingolipidomic profiling to quantify S1P and related metabolites using LC-MS/MS

  • Transcriptomic analysis to identify gene expression changes following SGPL1 modulation

  • Proteomic and phosphoproteomic assessment of affected signaling pathways

  • Functional assays specific to the physiological system under investigation

Statistical approaches for correlation analysis should include multivariate methods capable of handling high-dimensional data, such as principal component analysis or partial least squares regression. For temporal studies tracking SGPL1 function and physiological changes over time, mixed-effects models accommodate both within-subject and between-subject variability.

To establish causality beyond correlation, intervention studies using conditional or inducible SGPL1 knockout/knockin models provide the strongest evidence. When interpreting results, researchers should consider both direct effects of SGPL1 dysfunction and secondary compensatory mechanisms that may develop in chronic models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.