Recombinant Human Sphingosine 1-phosphate receptor 1 (S1PR1)

Shipped with Ice Packs
In Stock

Description

Molecular Architecture

S1PR1 is a seven-transmembrane (7TM) GPCR with distinct structural features:

  • Binding Pocket: An amphipathic orthosteric pocket accommodates zwitterionic S1P, accessible via the membrane bilayer rather than extracellular space .

  • Activation Mechanism: Cryo-EM structures reveal conformational changes upon agonist binding (e.g., S1P, Fingolimod-P, or CBP-307), including TM6 outward movement (8.3 Å) and TM7 inward swing (3.4 Å), facilitating Gαi coupling .

  • N-terminal Helix: Acts as a "cap," restricting ligand access and enabling slow receptor saturation .

Signaling Pathways

  • Vascular Integrity: Stabilizes endothelial cell adherens junctions via VE-cadherin retention, counteracting VEGF-induced permeability .

  • Immune Regulation: Mediates lymphocyte egress from lymphoid organs, a mechanism exploited by S1PR1 modulators like Fingolimod in multiple sclerosis .

  • Cardiac Function: Antagonizes β1-adrenergic receptor (β1AR) overstimulation in heart failure (HF), restoring cAMP balance and improving contractility .

Cardiovascular Disease

Recombinant S1PR1 gene therapy in post-myocardial infarction (MI) HF models demonstrated:

ParameterShamHF ControlHF + S1PR1 Therapy
Ejection Fraction (%)65.4 ± 0.926.9 ± 1.638.3 ± 1.8*†
LV dP/dt (mm Hg/s)6,494.8 ± 2444,461 ± 179.85,260 ± 245.7*†
LV End-Diastolic Pressure (mm Hg)2.2 ± 0.313.5 ± 1.17.7 ± 0.9*†

S1PR1 overexpression restored βAR density, reduced immune cell infiltration, and improved myocardial blood flow via Akt activation .

Inflammatory and Autoimmune Disorders

  • Multiple Sclerosis: Fingolimod (FTY720), a functional S1PR1 antagonist, internalizes the receptor to sequester lymphocytes, reducing relapse rates .

  • Inflammatory Bowel Disease (IBD): Elevated S1PR1 expression in endothelial cells correlates with improved barrier function in colitis models, suggesting therapeutic potential for Gi-biased agonists .

Cancer and Sepsis

  • Cancer Migration: S1PR1 activation in ovarian cancer and fibrosarcoma promotes invasion via Rac1/CDC42 and ERK pathways .

  • Sepsis Prognosis: A 16-gene S1PR1-associated signature predicts survival in sepsis patients (AUC = 0.84), highlighting its role in vascular and immune dysregulation .

Mechanistic Insights from Preclinical Models

  • Endothelial Dysfunction: S1PR1/Eng crosstalk enhances ERK signaling, promoting angiogenesis in hereditary hemorrhagic telangiectasia .

  • Ligand Bias: Nonlipid agonists like CBP-307 adopt a "shallow-to-deep" binding transition, stabilizing Gαi-membrane interactions distinct from lipid-like agonists .

Therapeutic Challenges and Future Directions

  • Targeted Delivery: Adenovirus-associated vectors (e.g., rAAV6) enable cardiac-specific S1PR1 expression, mitigating systemic side effects .

  • Disease-Specific Agonism: Gi-biased agonists may enhance endothelial barrier function without triggering lymphopenia, a limitation of current S1PR1 modulators .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
S1PR1; CHEDG1; EDG1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH PQKDEGDNPETIMSSGNVNSSS
Uniprot No.

Target Background

Function
Sphingosine 1-phosphate receptor 1 (S1PR1) is a G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P), primarily coupled to Gi proteins. Activation triggers downstream signaling cascades involving RAC1, SRC, PTK2/FAK1, and MAP kinases. S1PR1 plays a crucial role in various cellular processes, including cell migration (via actin cytoskeleton reorganization and lamellipodia formation), chemotaxis towards S1P, embryonic heart development, cardiac morphogenesis, angiogenesis regulation (inhibiting excessive sprouting), T-cell egress from the thymus, osteoclast precursor cell migration, bone mineralization, and bone homeostasis. Furthermore, it is involved in pulmonary endothelial cell responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine and protection against ventilator-induced lung injury.
Gene References Into Functions
  1. S1PR1 overexpression promoted subcutaneous xenograft growth, pulmonary metastases, and epithelial-to-mesenchymal transition (EMT) marker expression. (PMID: 30453284)
  2. BATF3 knockdown in Hodgkin lymphoma (HL) cell lines indicated BATF3's contribution to the transcriptional program of primary HL cells, including S1PR1 upregulation. (PMID: 28878352)
  3. S1PR1 exhibited an inhibitory effect on kidney ischemia/reperfusion injury-induced EMT by modulating the PI3K/Akt pathway. (PMID: 29901713)
  4. Extracellular α-synuclein induced S1PR1 uncoupling from inhibitory G-proteins, leaving β-arrestin signaling intact. (PMID: 28300069)
  5. ApoM overexpression promoted non-small cell lung cancer (NSCLC) cell proliferation and invasion via S1PR1 upregulation and ERK1/2 and PI3K/AKT pathway activation. (PMID: 29750961)
  6. S1P attenuated thyroid cancer cell invasion by activating S1P2 and the Rho-ROCK pathway, decreasing calpain activity, and reducing MMP2 and MMP9 expression and activity. (PMID: 29734379)
  7. Elevated S1PR1 expression and STAT3 activation were observed in human neuroblastoma (NB) cells with acquired etoposide resistance. S1PR1 antagonism (FTY720) sensitized resistant cells to etoposide. (PMID: 28716816)
  8. Sphingosine-1-phosphate receptor as a therapeutic target in ulcerative colitis. (PMID: 27494562)
  9. Astrocytic S1PR1 controls astrocyte neurotoxicity and monocyte recruitment and activation. (PMID: 28167760)
  10. High S1PR1 expression is associated with anti-neutrophil cytoplasmic antibody-associated vasculitis. (PMID: 28206609)
  11. Low S1PR1 expression is associated with Coxsackievirus B3-induced myocarditis. (PMID: 28986246)
  12. S1P and S1PR1 signaling are integral to lymphatic endothelial cell responses to fluid flow. (PMID: 27974574)
  13. S1PR1/3 silencing altered proliferation, adhesion, viability, and motility in breast cancer cells. (PMID: 28982858)
  14. Activated S1PR1 signaling regulates cellular adhesion molecule production by inhibiting NF-κB activation via β-arrestin2. (PMID: 28399143)
  15. S1P incorporated into recombinant HDL (rHDL) particles initiated S1PR1 internalization. (PMID: 27881715)
  16. Blocking S1PR activity and S1P synthesis decreased fibrosis and tissue remodeling-related protein expression in orbital fibroblasts from patients with Graves' ophthalmopathy (GO). (PMID: 28492873)
  17. Molecular dynamics simulations provided insights into S1P ligand entry into S1PR1. (PMID: 28370663)
  18. Mature human thymocytes utilize S1PR1 for migration towards S1P. (PMID: 27056271)
  19. ApoM-bound sphingosine-1-phosphate regulates adhesion molecule abundance, leukocyte-endothelial adhesion, and endothelial barrier function via S1PR1. (PMID: 27879252)
  20. S1P1,3 activation results in Akt phosphorylation and subsequent eNOS activation. (PMID: 27282481)
  21. HDL-associated ApoM is anti-apoptotic by delivering sphingosine 1-phosphate to S1P1 and S1P3 receptors. (PMID: 28179022)
  22. High S1PR1 expression in testicular diffuse large B-cell lymphoma suggests the S1P/S1PR1 axis as a therapeutic target. (PMID: 27061580)
  23. S1PR1 inhibits apoptosis and promotes proliferation of human myeloid leukemia cells. (PMID: 27572094)
  24. S1P signaling plays a role in multiple myeloma cell proliferation and drug resistance. (PMID: 27785703)
  25. Sphingosine 1-phosphate-induced IL-8 gene expression is regulated via S1PR1, and secretion via S1PR2. (PMID: 26321412)
  26. S1PR1 signaling influences the sensitivity of plasmacytoid dendritic cell (pDC) interferon responses. (PMID: 26787880)
  27. S1P and S1P1 are involved in the migration of precursor T-cell lymphoblastic leukemia-lymphoma blasts. (PMID: 26824863)
  28. miR148a overexpression or S1PR1 inhibition suppressed ovarian cancer cell migration and invasion. (PMID: 26004261)
  29. ApoM(+)HDL acts as a biased agonist on S1P1, inhibiting vascular inflammation. (PMID: 26268607)
  30. S1P receptor modulation reduces leukocyte migration across the endothelial barrier. (PMID: 26197437)
  31. SGPL1 ratio correlated with increased cellular S1P, which correlated with drug resistance. (PMID: 26493335)
  32. Sphingosine-1-phosphate is involved in the production of immature double-negative thymocytes in Chagas disease. (PMID: 25330249)
  33. S1PR1 is strongly expressed in mantle zone B cells, potentially playing a role in B-cell migration. (PMID: 26282174)
  34. Ponesimod, a selective S1P1 receptor modulator, causes dose-dependent QT prolongation. (PMID: 25287214)
  35. Rapid reduction of endothelial cell surface S1PR1 expression after Y143 phosphorylation modulates S1PR1 signaling and endothelial barrier repair. (PMID: 25588843)
  36. Sphingosine-1-phosphate promotes extravillous trophoblast cell invasion via S1P/S1PR1 and MEK/ERK/MMP-2 signaling. (PMID: 25188412)
  37. S1PR1 and S1PR2 play a role in hyperglycemia-induced endothelial dysfunction by modulating oxidative stress. (PMID: 25673082)
  38. S1PR1 expression is associated with unfavorable features and anti-apoptosis/proliferation markers in urothelial carcinoma. (PMID: 26238015)
  39. An SNP in S1PR1 (rs41287280) is associated with protection against coronary artery disease. (PMID: 25293589)
  40. S1PR1-PLC-IP3R-Ca2+-Rac1 pathway governs low-dose S1P-enhanced endothelial barrier integrity. (PMID: 25557733)
  41. S1P interacts with neutrophil receptors, activating NADPH oxidase via PI3K-Akt signaling and inducing respiratory burst. (PMID: 25872153)
  42. Review of S1P1's broad functions in the immune, vascular, and nervous systems. (PMID: 25498971)
  43. Ceramide-evoked neuronal cell death is regulated by PARP/PAR/AIF and S1P receptor signaling. (PMID: 24420784)
  44. B cell receptor signaling reduces functional S1PR1 expression in chronic lymphocytic leukemia cells. (PMID: 25632006)
  45. S1PR1 expression is differentially modulated in multiple sclerosis lesions. (PMID: 23551178)
  46. S1PR1 is a target of miR-125b-1-3p in the placenta, impacting trophoblast cell invasion. (PMID: 25251470)
  47. S1PR1 signaling in regulatory T cells differs between the periphery and tumors. (PMID: 24630990)
  48. Aberrant S1PR1 expression in colorectal cancer is associated with liver metastasis and worse survival. (PMID: 24972972)
  49. Sphingosine kinase SphK1 and S1P receptors (S1P1-5) are expressed in glioblastomas. (PMID: 24903384)
  50. Loss of S1P and sphingosine kinase activity occurs early in Alzheimer's disease pathogenesis. (PMID: 24456642)
Database Links

HGNC: 3165

OMIM: 601974

KEGG: hsa:1901

STRING: 9606.ENSP00000305416

UniGene: Hs.154210

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Membrane raft. Note=Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor internalization.
Tissue Specificity
Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.

Q&A

What is the structure and signaling mechanism of S1PR1?

S1PR1 is a G protein-coupled receptor with seven transmembrane domains that primarily couples to Gi proteins. Recent cryo-electron microscopy studies have revealed the structure of the S1PR1-Gi signaling complex bound to the biased agonist SAR247799 at a resolution of 3.47 Å, providing critical insights into the recognition mode for biased ligands . The receptor primarily signals through Gi-mediated pathways, which inhibit adenylyl cyclase and reduce cAMP production. Activation of S1PR1 triggers downstream signaling cascades involving transcription factors EGR1 (early growth response 1) and STAT3 (Signal Transducer And Activator of Transcription 3), which regulate the expression of genes including SPHK1 (sphingosine kinase 1) and SPNS2 (sphingolipid transporter 2) .

How is S1PR1 expression distributed across different tissues?

S1PR1 is ubiquitously expressed among tissues but shows variable expression patterns. In the central nervous system, autoradiography and immunohistochemistry studies have revealed region-specific distribution patterns. In human brain tissues, S1PR1 shows high expression in the molecular layer of the cerebellar cortex compared to the granular layer, and relatively high expression in the red nucleus and anterior thalamus regions . In the human striatal region, S1PR1 is primarily distributed in the putamen and caudate nucleus with lower expression in the internal capsule . Importantly, S1PR1 is highly expressed in endothelial cells of inflammatory bowel disease patients and positively correlates with endothelial markers .

What is the role of S1PR1 in endothelial barrier function?

S1PR1 plays a crucial role in maintaining and restoring endothelial barrier integrity. Endothelial cells (ECs) are primary components of blood and lymphatic vessels, serving as an anti-adhesive and selectively permeable exchange barrier . When EC dysfunction occurs, it impairs barrier integrity, leading to vascular dysplasia, enhanced leukocyte permeability, increased adhesion molecular expression, and dysregulated nitric oxide excretion .

Research has identified a specific population of S1PR1-active endothelial cells (S1PR1+EC) that appears during vascular injury. These cells are vital for reestablishing the endothelial barrier, as demonstrated by studies showing that transplantation of S1PR1+EC into the leaky vasculature of EC-specific S1PR1 null mice induced intimal integration and repaired the barrier . The protective mechanisms involve activation of transcription factors that amplify S1P generation and efflux, mediating vascular repair .

How can researchers effectively study S1PR1 expression in different tissue types?

Multiple complementary techniques provide comprehensive characterization of S1PR1 expression:

  • Radioligand binding assays: Using selective radioligands like [³H]CS1P1 enables determination of receptor density (Bmax) and binding affinity (Kd). Saturation binding data has shown that [³H]CS1P1 binds to human S1PR1 with a Kd value of 8.41 ± 1.43 nM and Bmax of 4156 ± 140.7 fmol/mg .

  • Autoradiography: This technique provides spatial information about S1PR1 distribution within tissues. In human frontal cortex tissue, [³H]CS1P1 binds to S1PR1 with a Kd of 3.98 nM and a Bmax of 172.5 nM .

  • Immunohistochemistry: Using validated S1PR1-specific antibodies confirms protein expression and localization, and when combined with cell-type-specific markers, identifies S1PR1-expressing cell populations .

  • In vivo imaging: PET tracers like [¹¹C]CS1P1 allow non-invasive assessment of S1PR1 expression in live subjects. This approach is particularly valuable for longitudinal studies and has advanced to clinical investigation in both healthy volunteers and patients with multiple sclerosis .

What are the approaches for developing and characterizing S1PR1-selective ligands?

Developing S1PR1-selective ligands requires multiple validation steps:

  • Competition binding assays: These assess ligand affinity and selectivity against recombinant receptor preparations. Compounds like CS1P1 have demonstrated high selectivity for S1PR1 with an IC₅₀ value of 2.13 nM and more than 1000-fold selectivity over other S1P receptors .

  • Functional assays: Measuring Gi-mediated signaling (cAMP inhibition, ERK phosphorylation) allows assessment of compound efficacy and potential biased signaling properties.

  • Structural studies: Cryo-electron microscopy of receptor-ligand complexes provides molecular insights into binding modes. For example, the structure of S1PR1-Gi signaling complex bound to the biased agonist SAR247799 revealed specific interactions that contribute to its biased signaling profile .

  • Radiolabeling strategies: Development of radiolabeled derivatives enables binding studies and in vivo imaging. The synthesis of [¹¹C]CS1P1 (previously named [¹¹C]TZ3321) has enabled PET imaging studies of S1PR1 in various disease models .

How does S1PR1 interact with other G protein-coupled receptors, particularly β1-adrenergic receptors?

S1PR1 and β1-adrenergic receptor (β1AR) exhibit significant cross-regulation with physiological implications:

  • Reciprocal downregulation: In HEK293 cells expressing both receptors, β1AR downregulation occurs after sphingosine-1-phosphate stimulation (an S1PR1 agonist), while S1PR1 downregulation can be triggered by isoproterenol (a β-adrenergic receptor agonist) treatment .

  • G protein-coupled receptor kinase-2 (GRK2) involvement: This interaction appears to be GRK2-dependent, with important physiological effects on cardiac hypertrophy, apoptosis, and remodeling .

  • Opposing signaling mechanisms: These receptors have opposing actions on adenylyl cyclase due to differential G-protein coupling (β1AR couples to Gs, increasing cAMP; S1PR1 couples to Gi, decreasing cAMP) .

  • Clinical relevance: In heart failure, S1PR1 downregulation exacerbates left ventricular dysfunction. This cross-talk appears to have physiological significance in mouse hearts undergoing chronic β-adrenergic receptor stimulation and in rat models of post-ischemic heart failure .

What are the therapeutic applications of targeting S1PR1 in different disease models?

S1PR1 modulation shows therapeutic potential in multiple disease contexts:

  • Inflammatory bowel disease (IBD): The Gi-biased agonist SAR247799 activated S1PR1 and reversed pathology in mouse and organoid IBD models by protecting the integrity of the endothelial barrier without affecting immune cell egress, providing an advantage over non-selective S1PR1 modulators that cause immunosuppression .

  • Acute lung injury: S1PR1 activation reduced acute lung injury in vascular injury models. The generation of S1PR1+ endothelial cells preceded lung endothelial repair, and these cells were vital for reestablishing the endothelial barrier .

  • Heart failure: Restoration of cardiac plasma membrane levels of S1PR1 through gene therapy produced beneficial effects in a rat model of post-ischemic heart failure. Twelve weeks after gene delivery with rAAV6-S1PR1, significant improvements were observed in:

    ParameterShamHF ControlHF with S1PR1 Gene Therapy
    LV Ejection FractionNormalDecreasedSignificantly improved
    End-diastolic diameterNormalIncreasedPrevented further dilatation
    +dP/dt (contractility)NormalReducedSignificantly improved
    −dP/dt (relaxation)NormalReducedSignificantly improved
    LV systolic pressureNormalReducedIncreased
    LV end-diastolic pressureNormalIncreasedDecreased

    These improvements occurred without affecting infarct size, as gene therapy was performed 8 weeks after myocardial infarction when the scar was completely established .

What methodological approaches are used to study S1PR1-mediated effects in vivo?

Several methodological approaches provide comprehensive assessment of S1PR1 function:

  • Gene therapy approaches: Recombinant adeno-associated virus serotype 6 (rAAV6) has been successfully used for cardiac-targeted S1PR1 gene delivery in heart failure models. Transgene expression can be confirmed through immunohistochemistry, reverse-transcription polymerase chain reaction, and immunoblotting .

  • Imaging techniques: [¹¹C]CS1P1 PET imaging allows visualization of S1PR1 expression and drug target engagement in living subjects. This radiotracer has been evaluated in rodent models of vascular injury, atherosclerosis, and multiple sclerosis, demonstrating its utility for investigating S1PR1 function in vivo .

  • Physiological assessments: Echocardiography and invasive hemodynamic measurements provide functional readouts in cardiovascular studies. In heart failure models, improvements in left ventricular ejection fraction, end-diastolic diameter, and pressure derivatives (+dP/dt, -dP/dt) demonstrated the beneficial effects of S1PR1 overexpression .

  • Histological analysis: Immunohistochemistry can assess S1PR1 expression patterns and associated pathological changes. For example, S1PR1 gene delivery in heart failure models reduced infiltration of immune cells compared to control groups .

What controls should be included when studying recombinant S1PR1?

When designing experiments with recombinant S1PR1, include the following controls:

  • Vector controls: When using viral vectors for S1PR1 expression (e.g., rAAV6-S1PR1), include appropriate empty vector controls (e.g., rAAV6-GFP) to account for vector-specific effects .

  • Ligand specificity controls: Include competition with known S1PR1-selective compounds and the endogenous ligand S1P to confirm binding specificity of novel compounds .

  • Receptor expression verification: Confirm S1PR1 expression using multiple methods (immunoblotting, RT-PCR, immunohistochemistry) to ensure successful transfection/transduction .

  • Signaling pathway controls: Include positive and negative controls for downstream signaling pathways (Gi activation inhibitors, adenylyl cyclase modulators) to confirm functional coupling.

  • Cell type controls: For endothelial barrier studies, compare S1PR1 effects in endothelial cells versus other cell types to confirm cell-specific functions .

How can researchers optimize transfection conditions for recombinant S1PR1 expression?

Optimizing S1PR1 expression requires consideration of several factors:

  • Expression system selection: Choose appropriate cell lines (HEK293, CHO) for recombinant expression based on endogenous GPCR expression levels and signaling machinery.

  • Vector design: Include appropriate promoters (CMV for high expression, tissue-specific promoters for targeted expression) and codon optimization for the host species.

  • Transfection method optimization: Compare lipid-based transfection, electroporation, and viral transduction for efficiency in your specific cell type.

  • Expression verification: Implement multiple detection methods including Western blotting, flow cytometry, and functional assays to confirm expression of properly folded, functional receptor.

  • Stable line generation: For long-term studies, develop stable cell lines with consistent S1PR1 expression levels to reduce experimental variability.

  • Receptor density considerations: Titrate expression levels to physiologically relevant densities, as overexpression may alter trafficking, signaling bias, or constitutive activity.

What are the challenges in developing biased agonists for S1PR1?

Developing biased S1PR1 agonists presents several methodological challenges:

  • Assay selection: Multiple complementary assays are required to detect and quantify signaling bias, including G protein activation, β-arrestin recruitment, and downstream effector activation.

  • Reference compound selection: Appropriate reference ligands (balanced agonists like S1P) must be included to normalize responses and calculate bias factors.

  • Structural determinants: Understanding the structural basis of biased signaling requires high-resolution structural studies. The cryo-EM structure of S1PR1-Gi signaling complex bound to the biased agonist SAR247799 at 3.47 Å resolution has provided valuable insights into the molecular mechanisms of biased activation .

  • Translational challenges: In vitro bias profiles may not directly translate to in vivo efficacy and safety. SAR247799 demonstrated Gi-biased activation of S1PR1 that protected endothelial barrier function without affecting immune cell egress, showing successful translation of biased signaling to therapeutic benefit .

  • Target validation: Confirming that observed therapeutic effects result from the intended biased signaling pathway rather than off-target effects requires careful pharmacological validation.

How can researchers effectively measure S1PR1-mediated effects on endothelial barrier function?

Multiple complementary approaches provide comprehensive assessment of S1PR1's role in endothelial barrier function:

  • In vitro barrier assays: Transendothelial electrical resistance (TEER) measurements provide real-time, quantitative assessment of barrier integrity in endothelial monolayers. Permeability assays using fluorescently labeled macromolecules can quantify barrier leakage.

  • Molecular readouts: Visualization of adherens junction proteins (VE-cadherin, β-catenin) and cytoskeletal components (F-actin) using immunofluorescence microscopy reveals barrier-enhancing mechanisms.

  • Ex vivo models: Isolated vessel preparations can assess endothelial function in intact vessels with preservation of cell-cell interactions.

  • Disease models: Models of inflammatory bowel disease and acute lung injury provide physiologically relevant contexts to assess S1PR1-targeted interventions. In these models, S1PR1 activation has been shown to reverse pathology by protecting endothelial barrier integrity .

  • Functional validation: Transplantation of S1PR1+ endothelial cells into the leaky vasculature of EC-specific S1PR1 null mice provides functional validation of S1PR1's role in barrier repair .

What are the key considerations for interpreting S1PR1 signaling data?

Proper interpretation of S1PR1 signaling data requires careful consideration of:

  • Receptor expression levels: Expression level affects signaling magnitude and potentially pathway bias. Compare results to systems with physiological expression levels.

  • Cell type context: Signaling outcomes may differ between cell types based on expression of effector proteins. S1PR1 signaling in endothelial cells may differ from effects in immune cells or cardiomyocytes.

  • Temporal dynamics: Consider both rapid (seconds to minutes) G protein-mediated signaling and longer-term (hours to days) transcriptional effects. S1PR1 activation leads to both immediate cytoskeletal reorganization and longer-term transcriptional changes via EGR1 and STAT3 .

  • Pathway crosstalk: S1PR1 signaling interacts with other pathways, including β1-adrenergic receptor signaling. This receptor cross-talk has significant physiological effects on cardiac hypertrophy, apoptosis, and remodeling .

  • Desensitization and internalization: S1PR1 undergoes agonist-induced desensitization and internalization, which affects signaling duration and may contribute to therapeutic effects of some compounds.

How can researchers design effective gene therapy approaches targeting S1PR1?

Based on successful S1PR1 gene therapy in heart failure models, key design considerations include:

  • Vector selection: Recombinant adeno-associated virus serotype 6 (rAAV6) has been successfully used for cardiac-targeted S1PR1 gene delivery .

  • Promoter choice: Select promoters with appropriate tissue specificity and expression level to avoid off-target effects.

  • Timing of intervention: In post-myocardial infarction heart failure, S1PR1 gene therapy was effective when delivered 8 weeks after infarction, when the scar was fully established .

  • Expression verification: Confirm transgene expression using multiple methods including immunohistochemistry, RT-PCR, and Western blotting .

  • Outcome measures: Include both molecular endpoints (receptor expression, signaling pathway activation) and physiological outcomes (cardiac function parameters, inflammation markers, remodeling indices) .

  • Long-term assessment: Monitor effects over extended periods. In heart failure models, S1PR1 gene therapy produced sustained functional improvements over 12 weeks post-delivery .

How can researchers resolve conflicting data regarding S1PR1 function in different experimental systems?

When encountering contradictory results across experimental systems:

  • Compare expression levels: Differences in receptor density can affect signaling outcomes and pharmacological responses.

  • Examine cell type context: S1PR1 function may differ between cell types due to varying expression of signaling partners and effectors.

  • Consider species differences: Human and rodent S1PR1 may exhibit differences in ligand binding, signaling coupling, or regulation.

  • Evaluate ligand selectivity: Ensure compounds used are truly selective for S1PR1 over other S1P receptor subtypes.

  • Assess receptor coupling: Confirm proper G protein coupling using functional assays that directly measure Gi activation.

  • Examine pathway crosstalk: Interactions with other receptors, such as β1-adrenergic receptors, may influence outcomes .

  • Consider disease context: S1PR1 function may differ between normal physiological conditions and disease states, as receptor expression and signaling can be altered in pathological contexts .

What are common pitfalls in S1PR1 research and how can they be avoided?

Common challenges in S1PR1 research include:

  • Reagent specificity: Many commercially available antibodies lack specificity. Validate antibodies using knockout controls or multiple antibodies targeting different epitopes.

  • Ligand selectivity: S1P activates all five S1P receptor subtypes. Use receptor subtype-selective compounds and genetic approaches to confirm S1PR1-specific effects.

  • Receptor internalization: S1PR1 rapidly internalizes upon activation, complicating interpretation of signaling duration. Monitor receptor localization alongside signaling readouts.

  • Endogenous S1P: Background S1P levels in serum-containing media can partially activate S1PR1. Consider serum starvation or charcoal-stripped serum for baseline measurements.

  • Receptor overexpression artifacts: Excessive expression can lead to constitutive activity or altered signaling. Use inducible expression systems and titrate to physiological levels.

  • Complex in vivo phenotypes: Global manipulation of S1PR1 affects multiple cell types. Use cell-specific knockout or overexpression approaches to dissect cell-autonomous functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.