Recombinant Human Sphingosine 1-phosphate receptor 2 (S1PR2)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Overview

Recombinant Human Sphingosine 1-Phosphate Receptor 2 (S1PR2) is a lab-engineered form of the G protein-coupled receptor (GPCR) encoded by the S1PR2 gene. Produced via recombinant DNA technology, this protein binds the bioactive lipid sphingosine 1-phosphate (S1P) to mediate downstream signaling pathways such as PI3K, MAPK, and Rho/ROCK . S1PR2 is widely expressed in vascular, neuronal, and immune cells, where it regulates processes including cell migration, inflammation, and barrier integrity .

A. Inflammatory Regulation

  • Proinflammatory Cytokine Production: S1PR2 knockdown reduces IL-1β, IL-6, and TNF-α in macrophages exposed to pathogens like A. actinomycetemcomitans .

  • Sepsis: S1PR2 deficiency in macrophages upregulates IL-33 and type 2 immunity, mitigating lung injury .

  • Atherosclerosis: Myeloid S1PR2 promotes plaque retention of macrophages and secretion of IL-1β/IL-18, driving vascular inflammation .

B. Neurological and Vascular Pathologies

  • Blood-Brain Barrier (BBB) Disruption: S1PR2 overexpression post-traumatic brain injury (TBI) upregulates MMP-9 via JNK/c-Jun, degrading tight-junction proteins .

  • Ischemic Stroke: S1PR2 activation increases cerebrovascular permeability, exacerbating edema and hemorrhage .

C. Metabolic and Fibrotic Diseases

  • Diabetes: S1PR2-specific radiotracer [<sup>11</sup>C]TZ34125 shows elevated uptake in pancreatic and splenic tissues of diabetic mice, implicating S1PR2 in inflammation .

  • Osteoclastogenesis: S1PR2 inhibition suppresses RANKL-induced osteoclast differentiation by downregulating NFATc1 and cathepsin K .

Key Research Findings

Study TypeKey FindingReference
Cryo-EM AnalysisS1PR2-G<sub>13</sub> complex structure reveals activation mechanism and FTY720-P agonism
In Vivo KnockdownS1PR2 shRNA reduces sepsis-associated lung injury and enhances type 2 immunity
Radioligand Development[<sup>11</sup>C]TZ34125 confirms S1PR2 as a biomarker for diabetic inflammation
Therapeutic InhibitionJTE-013 (S1PR2 antagonist) attenuates atherosclerosis and BBB disruption
Bacterial InflammationS1PR2 mediates IL-1β/IL-6/TNF-α release in A. actinomycetemcomitans infection

A. Pharmacological Modulators

CompoundTypeEffectApplication
JTE-013AntagonistReduces IL-1β/IL-18, mitigates atherosclerosisPreclinical trials
FTY720-PAgonistActivates G<sub>13</sub> via S1PR2Multiple sclerosis research
[<sup>11</sup>C]TZ34125RadioligandDetects S1PR2 in diabetic tissuesDiagnostic imaging

B. Disease Associations

  • Atherosclerosis: Myeloid S1PR2 drives plaque progression; JTE-013 reduces lesion volume by 74% in mice .

  • Traumatic Brain Injury: S1PR2 inhibition decreases MMP-9, preserving BBB integrity .

  • Severe Acute Pancreatitis (SAP): S1PR2 regulates macrophage pyroptosis, exacerbating intestinal injury .

Challenges and Future Directions

  • Drug Selectivity: FTY720-P activates S1PR2 despite targeting other S1PRs, complicating therapeutic use .

  • Translational Gaps: Poor pharmacokinetics of JTE-013 limit clinical adoption .

  • Emerging Tools: Radioligands like [<sup>11</sup>C]TZ34125 may enable non-invasive S1PR2 monitoring in humans .

Future research should prioritize isoform-specific modulators and large-animal studies to validate S1PR2’s role in metabolic and inflammatory disorders .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order remarks section, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products can be influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C, while lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know, and we will prioritize developing it during production.
Synonyms
S1PR2; EDG5; Sphingosine 1-phosphate receptor 2; S1P receptor 2; S1P2; Endothelial differentiation G-protein coupled receptor 5; Sphingosine 1-phosphate receptor Edg-5; S1P receptor Edg-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
Uniprot No.

Target Background

Function
Sphingosine 1-phosphate receptor 2 (S1PR2) serves as a receptor for both the lysosphingolipid sphingosine 1-phosphate (S1P) and the chemokine-like protein FAM19A5. S1P, a bioactive lysophospholipid, exerts diverse physiological effects on various cell types and tissues. When expressed in rat HTC4 hepatoma cells, S1PR2 mediates S1P-induced cell proliferation and suppression of apoptosis. Additionally, S1PR2 is involved in mediating the inhibitory effect of FAM19A5 on vascular smooth muscle cell proliferation and migration.
Gene References Into Functions
  1. Both SphK1 overexpression and S1P addition increased mTOR phosphorylation, as evidenced by ELISA, whereas S1PR2 inhibition had the opposite effect. These findings suggest that CerS6 and SphK1 regulate mTOR signaling in breast cancer cell proliferation. Furthermore, mTOR activity can be regulated by the balance between S1P and C16ceramide, which is produced by CerS6. PMID: 30226616
  2. While extravillous trophoblasts express three S1P receptor isoforms, S1P predominantly signals through S1PR2/Galpha12/13 to activate Rho, thereby acting as a potent inhibitor of extravillous trophoblast migration. PMID: 29208234
  3. SNPs within 0.1 Mb of the S1PR2 gene and within the gene itself were analyzed as candidate gene associations for hearing loss. For 1 kHz thresholds, SNP rs74930654 showed the most significant association. For 4 kHz, the most significant association was with rs201930568. These findings suggest that variants affecting the S1PR2 gene contribute to auditory thresholds in the UK population. PMID: 27383011
  4. High S1PR2 expression is associated with anti-neutrophil cytoplasmic antibody-associated vasculitis. PMID: 28206609
  5. CONCLUSION: MiR-126 down-regulated S1PR2, preventing the activation of the PI3K/AKT signaling pathway, ultimately impairing intestinal mucosal barrier function. PMID: 28302479
  6. Data suggest that activation of SR-BI by APOAI down-regulates sphingosine 1-phosphate/S1PR2-mediated inflammation in vascular endothelial cells by activating the PI3K/Akt signaling pathway. Conversely, oxidized-LDL has the opposite effect. (APOA1 = apolipoprotein A-I; SR-BI/SCARB1 = scavenger receptor class B type I; S1PR2 = sphingosine 1-phosphate receptor 2; PI3K = phosphatidylinositol 3-kinase; Akt = proto-oncogene c-akt) PMID: 28181168
  7. S1PR2 mediates Rho activation in normal cells adjacent to RasV12-transformed cells. PMID: 26631556
  8. Sphingosine 1-phosphate-induced IL-8 gene expression is primarily regulated via S1PR(1), while its secretion is regulated through the S1PR(2) receptor subtype. PMID: 26321412
  9. S1PR2 is repressed by FOXP1 in activated B-cell and germinal center B-cell DLBCL cell lines with aberrantly high FOXP1 levels. S1PR2 expression is further inversely correlated with FOXP1 expression in 3 DLBCL patient cohorts. PMID: 26729899
  10. LXR-alpha might downregulate S1PR2 expression via miR-130a-3p in quiescent HUVECs. Stimulation of TNF-alpha attenuates the activity of LXR-alpha and results in enhanced S1PR2 expression. PMID: 26669941
  11. S1PR2 can be detected in the human cerebrovascular endothelium. PMID: 26243335
  12. S1PR2 plays a critical role in TCA-induced COX-2 expression and CCA growth and may represent a novel therapeutic target for CCA. PMID: 26518876
  13. Both S1PR1 and S1PR2 play a crucial role in hyperglycemia-induced EC dysfunction and endothelial injury by reducing and enhancing the production of oxidative stress, respectively. PMID: 25673082
  14. AB1 displayed potency at least equivalent to JTE-013 in affecting signaling molecules downstream of S1P2. PMID: 26105954
  15. Activation of S1PR2-calcium influx-RhoA/ROCK dominates the high-dose S1P-induced endothelial monolayer hyperpermeability response. PMID: 25557733
  16. Data indicate that sphingosine 1-phosphate (S1P) and hepatocyte growth factor (HGF) induce translocation of integrin beta4, S1P receptors S1PR2 and S1PR3 to endothelial cell membrane caveolin-enriched microdomains (CEMs). PMID: 24851274
  17. The S1P2R specifically activates RhoC via G12/13 proteins and LARG. PMID: 23993968
  18. Sphingosylphosphorylcholine stimulates alpha-SMA protein expression and human lung fibroblast mediated collagen gel contraction via S1P2 receptor. PMID: 24614064
  19. Conjugated bile acids promote cholangiocarcinoma growth through S1PR2. PMID: 24700501
  20. S1PR2 expression was increased in disease-susceptible regions of the CNS of female patients with multiple sclerosis compared with their male counterparts. PMID: 24812668
  21. Our research provides evidence that S1PR1/3, but not S1PR2, negatively regulate the expression of collagen in hMSCs using cellular and molecular approaches. PMID: 24038457
  22. Extracellular S1P induces COX-2 expression via activation of S1P2 and subsequent Gi and p42/p44 MAPK-dependent signaling in renal mesangial cells, leading to enhanced PGE2 formation and cell migration that essentially requires COX-2. PMID: 24064301
  23. Activation of the S1P2 receptor counteracts the detrimental phosphorylation of p38 MAPK by IL-1beta. PMID: 23666803
  24. S1PR2 is a key regulator of the proinflammatory phenotype of the endothelium. PMID: 23723450
  25. S1P agonists are pro-fibrotic via S1P2R and S1P3R stimulation using Smad-independent pathways. PMID: 23589284
  26. Sphingosine 1-phosphate (S1P) receptors 1 and 2 coordinately induce mesenchymal cell migration through S1P activation of complementary kinase pathways. PMID: 23300082
  27. Our research identified the S1PR2 as the specific and necessary receptor to induce phosphorylation of ERM proteins and subsequent filopodia formation. PMID: 23106337
  28. S1P receptors S1P1,2,3 are expressed in human anaplastic thyroid cancer C643 and THJ-16T cells at both mRNA and protein levels. PMID: 22889737
  29. Abdominal aortic aneurysms exhibit down-regulation of the S1P2 protein with simultaneous up-regulation of the S1P3 protein, but not S1P1. PMID: 22547907
  30. Inflammatory mediators lipopolysaccharide and TNF-alpha induce S1PR2 expression in endothelium, suggesting that S1PR2 up-regulation may be involved in LPS and TNF-alpha elicited endothelial barrier dysfunction. PMID: 22244964
  31. The SphK/S1P/S1PRs signaling axis plays a significant role in liver fibrosis and is involved in the directed migration of hepatic myofibroblasts into the damaged areas. PMID: 21145832
  32. S1PR2, but not S1P1 or S1P3, receptor activation increases conventional outflow resistance in whole-eye perfusions. PMID: 21289286
  33. S1PR2 receptors play a critical role in regulating human mast cell functions, including degranulation and cytokine and chemokine release. PMID: 20194630
  34. Suppresses rac protein, a Rho family G protein and cell motility. PMID: 11915348
  35. Amyloid beta-protein stimulated in monocytes the gene expression for sphingosine-1-phosphate receptor 5, which is amyloid beta-protein-induced migration. PMID: 15208267
  36. S1P2R receptor actively regulates the PTEN phosphatase by a Rho GTPase-dependent pathway to inhibit cell migration. PMID: 15764699
  37. S1P2R activation in endothelial cells increases vascular permeability. The balance of S1P1 and S1P2 receptors in the endothelium may determine the regulation of vascular permeability by S1P. PMID: 17431187
  38. Antagonism of the S1P2R may be a novel therapeutic approach for the prevention and/or treatment of pathologic ocular neovascularization. PMID: 17710232
  39. These results suggest that S1P(2) receptors/G(12/13)-proteins/Rho signaling pathways mediate S1P-induced inhibition of glioma cell migration. PMID: 18088600
  40. Results suggest that S1PR2 is involved in COX2-dependent effects of high-density lipoprotein on vascular smooth muscle. PMID: 18612546
  41. Plays essential roles in the pathogenesis of rheumatoid arthritis by modulating fibroblast-like synoviocytes migration, cytokine/chemokine production, and cell survival. PMID: 18658144
  42. Impairment of function in senescent ECs in culture is mediated by an increase in S1P signaling through S1P(2)-mediated activation of the lipid phosphatase PTEN. PMID: 18765664
  43. These data suggest that CTGF protein induced by S1P2 might act as a growth inhibitor in Wilms' tumor. PMID: 18922980
  44. The S1P(2) receptor is involved in S1P-induced platelet aggregation and Rho kinase activation. PMID: 19139947
  45. S1P(2) signaling may play a critical role in suppressing diffuse large B-cell lymphoma. PMID: 19903857

Show More

Hide All

Database Links

HGNC: 3169

OMIM: 605111

KEGG: hsa:9294

STRING: 9606.ENSP00000466933

UniGene: Hs.655405

Involvement In Disease
Deafness, autosomal recessive, 68 (DFNB68)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sphingosine 1-Phosphate Receptor 2 (S1PR2) and what are its primary functions?

Sphingosine 1-Phosphate Receptor 2 (S1PR2) is a G-protein-coupled receptor that belongs to the endothelial differentiation gene (EDG) family of proteins. Upon activation by sphingosine 1-phosphate (S1P) or other ligands, S1PR2 initiates several downstream signaling pathways including phosphoinositide 3-kinase (PI3K), mitogen-activated protein kinase (MAPK), and Rho/Rho-associated coiled-coil containing kinases (ROCK) . S1PR2 plays crucial roles in various physiological processes including cell proliferation, survival, and transcriptional activation .

The receptor contributes to diverse biological functions and plays a pivotal role in various physiological processes and disease progressions, particularly in multiple sclerosis, fibrosis, inflammation, and tumor development . S1PR2 is expressed in a wide variety of tissues, with each subtype exhibiting different cell specificity, allowing for targeted research approaches .

How does S1PR2 differ from other sphingosine 1-phosphate receptors?

S1PR2 is one of five known sphingosine 1-phosphate receptors (S1P1-S1P5), each with distinct signaling properties and tissue distribution. While all S1P receptors are G-protein-coupled receptors that respond to the bioactive lysophospholipid sphingosine 1-phosphate, S1PR2 has unique structural and functional characteristics that differentiate it from other S1P receptors .

Unlike S1PR1, which primarily couples to Gi proteins and promotes cell migration, S1PR2 predominantly couples to G12/13 proteins, leading to Rho activation and inhibition of cell migration in many cell types . S1PR2 also has distinct tissue expression patterns compared to other S1P receptors, with particularly important roles in the nervous system, vascular system, and immune regulation .

Gene ontology annotations specifically related to S1PR2 include G protein-coupled receptor activity and integrin binding, which may not be shared across all S1P receptor subtypes . Additionally, defects in S1PR2 have been specifically associated with congenital profound deafness (Deafness, Autosomal Recessive 68), a connection not seen with other S1P receptors .

What are the known signaling pathways activated by S1PR2?

The activation of S1PR2 by sphingosine 1-phosphate initiates several major signaling cascades:

  • PI3K Pathway: S1PR2 can both activate and inhibit the PI3K pathway depending on the cellular context, influencing cell survival and proliferation .

  • MAPK Pathway: S1PR2 activates the mitogen-activated protein kinase pathway, which regulates gene expression, cell proliferation, and differentiation .

  • Rho/ROCK Pathway: A major signaling pathway downstream of S1PR2 involves the activation of Rho GTPases and Rho-associated kinases, which primarily regulate cytoskeletal reorganization and cell migration .

  • GPCR Downstream Signaling: As a G-protein-coupled receptor, S1PR2 engages in classic GPCR signaling mechanisms, including G protein-coupled second messenger systems .

These signaling pathways contribute to the diverse biological functions of S1PR2, including its roles in the nervous system, immune system, and various pathological conditions .

What is the current understanding of S1PR2's role in neurological disorders?

S1PR2 has emerged as a significant component in the pathophysiology of several neurological disorders. In multiple sclerosis (MS), which is characterized by inflammatory demyelination in the central nervous system, S1PR2 contributes to the inflammatory process . The effectiveness of fingolimod, a functional antagonist of S1P receptors, in treating relapsing-remitting MS underscores the importance of S1P signaling in this condition .

In Alzheimer's disease (AD), there are contradictory findings regarding S1PR2 activity. Some studies report increased SK2 (an enzyme involved in S1P production) activity in the frontal cortex of AD brains, while others note decreased activity in the temporal cortex and hippocampus . This inconsistency likely reflects the complexity of sphingolipid metabolism regulation in different brain regions. Interestingly, the subcellular localization of SK2 appears altered in AD brains, with preferential nuclear localization and reduced cytoplasmic expression correlating with amyloid-β (Aβ) deposits .

In Parkinson's disease (PD) models, a marked decrease in SK2 levels has been observed in the substantia nigra of MPTP-treated mice. Inhibition of SK2 in dopaminergic neurons led to decreased expression of genes regulating mitochondrial function, ATP depletion, reduction of superoxide dismutase 2 levels, and increased reactive oxygen species (ROS) . These findings suggest a neuroprotective role for the S1P/SK2 pathway in dopaminergic neurons, which are primarily affected in PD.

In Huntington's disease (HD), recent studies indicate altered expression of S1P-metabolizing enzymes in various HD models, including animal models, human brain tissues, and cultured cells . This suggests dysregulation of S1P metabolism and signaling in HD pathogenesis.

How do S1PR2 modulators affect experimental models of neuroinflammation?

S1PR2 modulators have shown significant effects in experimental models of neuroinflammation. Fingolimod, an S1P receptor modulator approved for treating multiple sclerosis, has been extensively studied in various neuroinflammatory models with promising results .

In Alzheimer's disease models, fingolimod has demonstrated multiple beneficial effects:

  • Reduction of Aβ-induced neuronal damage in rat hippocampus

  • Improvement of cognitive impairment associated with Aβ toxicity

  • Decrease in both soluble and insoluble Aβ levels in mouse models

  • Reduction in Aβ plaque density

  • Decreased activation of astrocytes while enhancing their phagocytic activity, potentially contributing to reduced Aβ accumulation

In Parkinson's disease models, S1PR modulators have shown neuroprotective effects:

  • Administration of fingolimod protected against neurodegeneration and behavioral effects in mouse PD models induced by MPTP, 6-hydroxydopamine, or rotenone

  • The neuroprotective effects appear to be mediated through S1P1 signaling and likely involve Akt pathway activation

  • Modified versions of fingolimod (FTY720 C2 or FTY720-Mitoxy) have been shown to increase BDNF levels and activate protein phosphatase 2A (whose activity is impaired in PD)

  • Long-term oral administration of fingolimod reduced alpha-synuclein aggregation and increased BDNF levels in transgenic mice overexpressing mutant human alpha-synuclein

These findings highlight the potential of S1PR2 modulators as therapeutic agents for neuroinflammatory conditions and suggest complex mechanisms involving both direct neuroprotection and modulation of glial cell functions.

What are the contradictions in current research regarding S1PR2 expression and function in disease states?

Several notable contradictions and knowledge gaps exist in the current understanding of S1PR2 expression and function in disease states:

What are the recommended protocols for expressing and purifying recombinant human S1PR2 for structural studies?

For successful expression and purification of recombinant human S1PR2, researchers should consider the following methodological approach:

Expression System Selection:

  • Mammalian expression systems (HEK293 or CHO cells) are preferred for recombinant human S1PR2 expression due to their ability to perform post-translational modifications necessary for proper receptor folding and function

  • Baculovirus-insect cell expression systems (Sf9 or High Five) represent an alternative that balances yield with post-translational modification capabilities

  • E. coli-based expression is generally not recommended for full-length S1PR2 due to limitations in membrane protein folding and post-translational modifications

Construct Optimization:

  • Include a purification tag (His8 or His10 tags) preferably at the C-terminus to minimize interference with ligand binding

  • Consider fusion partners such as T4 lysozyme or BRIL to enhance stability and crystallizability if structural studies are planned

  • Truncate or modify intracellular loops or C-terminal tails that might cause aggregation

  • Introduce specific point mutations (e.g., in palmitoylation sites) that have been shown to enhance stability without affecting function

Solubilization and Purification:

  • Membrane preparation: Harvest cells and disrupt using nitrogen cavitation or sonication

  • Membrane solubilization: Use appropriate detergents (e.g., n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG))

  • Affinity chromatography: Utilize immobilized metal affinity chromatography (IMAC) with the His-tag

  • Size exclusion chromatography: Further purify the protein and assess its homogeneity

  • Consider lipid nanodisc or amphipol reconstitution for enhanced stability

Quality Control Assessments:

  • Purity assessment via SDS-PAGE and western blotting

  • Homogeneity verification via dynamic light scattering

  • Functional validation through ligand binding assays

  • Thermal stability assessment using differential scanning fluorimetry

This methodology provides a starting point that should be optimized based on the specific requirements of individual research projects and the intended applications of the purified receptor.

What are the most effective approaches for studying S1PR2-ligand interactions?

Several complementary approaches can be employed to study S1PR2-ligand interactions effectively:

Computational Methods:

  • Homology modeling based on crystal structures of related GPCRs

  • Molecular docking simulations to predict binding modes of known and novel ligands

  • Molecular dynamics simulations to understand the dynamic nature of receptor-ligand interactions

  • Structure-based virtual screening to identify potential novel ligands

Binding Assays:

  • Radioligand binding assays using [³H]- or [¹²⁵I]-labeled ligands to determine binding affinity (Kd) and receptor density

  • Fluorescence-based binding assays using fluorescently labeled ligands

  • Surface plasmon resonance (SPR) to study binding kinetics in real-time

  • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding

Functional Assays:

  • G-protein activation assays (e.g., [³⁵S]GTPγS binding)

  • Calcium mobilization assays using fluorescent calcium indicators

  • ERK phosphorylation assays to monitor MAPK pathway activation

  • Rho activation assays to monitor effects on cytoskeletal reorganization

  • β-arrestin recruitment assays to assess receptor internalization

Advanced Structural Methods:

  • X-ray crystallography of S1PR2 in complex with ligands (challenging but provides highest resolution)

  • Cryo-electron microscopy for structure determination with less protein and potentially in more native-like environments

  • Hydrogen-deuterium exchange mass spectrometry to identify ligand-induced conformational changes

  • Nuclear magnetic resonance (NMR) spectroscopy for dynamic studies of ligand binding

Cell-Based Phenotypic Assays:

  • Cell migration assays to assess functional outcomes of receptor activation

  • Reporter gene assays to monitor transcriptional effects

  • Cytoskeletal reorganization assays using fluorescence microscopy

  • Electrophysiological recordings in neurons or other excitable cells

By combining multiple approaches, researchers can develop a comprehensive understanding of how different ligands interact with S1PR2 and the resulting functional consequences, aiding in the development of more selective and effective modulators.

How can researchers effectively distinguish between effects mediated by S1PR2 versus other S1P receptor subtypes?

Distinguishing between effects mediated by S1PR2 versus other S1P receptor subtypes requires careful experimental design and multiple complementary approaches:

Pharmacological Tools:

  • Use of subtype-selective agonists and antagonists:

    • JTE-013 as a relatively selective S1PR2 antagonist

    • CYM-5478 as an S1PR2-selective agonist

    • Contrasting with selective tools for other subtypes (e.g., SEW2871 for S1PR1)

  • Combine multiple selective tools to build a pharmacological profile of responses

  • Be aware of potential off-target effects of supposedly selective compounds

Genetic Approaches:

  • CRISPR/Cas9-mediated knockout of specific S1P receptor subtypes

  • siRNA or shRNA-mediated knockdown to reduce expression of specific subtypes

  • Overexpression of wild-type or dominant-negative forms of specific receptors

  • Use of cells derived from receptor subtype-specific knockout animals

Signaling Pathway Analysis:

  • Focus on pathways preferentially activated by S1PR2 (e.g., Rho/ROCK pathway)

  • Compare with pathways predominantly regulated by other subtypes (e.g., Gi-mediated pathways for S1PR1)

  • Use pathway-specific inhibitors to dissect contributions of individual signaling cascades

  • Monitor multiple signaling outputs simultaneously to build a comprehensive profile

Spatiotemporal Resolution:

  • Consider the tissue-specific expression patterns of different S1P receptor subtypes

  • Examine the temporal dynamics of responses, as different subtypes may mediate effects with different kinetics

  • Use cell type-specific conditional knockout models for in vivo studies

Practical Experimental Design Recommendations:

  • Always include appropriate positive and negative controls

  • Validate key findings using multiple complementary approaches

  • Consider potential compensatory upregulation of other receptor subtypes when one is inhibited or knocked out

  • Be cautious about extrapolating from in vitro to in vivo contexts, as the relative contributions of different receptor subtypes may vary

  • Consider the influence of the specific cellular and tissue microenvironment, which may affect receptor expression and function

By employing these strategies, researchers can more confidently attribute specific biological effects to S1PR2 versus other S1P receptor subtypes, leading to a clearer understanding of the receptor's unique roles in physiological and pathological processes.

How can recombinant S1PR2 be used to develop novel therapeutic strategies for neurological disorders?

Recombinant S1PR2 serves as a valuable tool for developing novel therapeutic strategies for neurological disorders through several research approaches:

Target Validation and Drug Discovery:

  • High-throughput screening assays using recombinant S1PR2 can identify novel selective modulators with potential therapeutic value

  • Structure-function studies with recombinant S1PR2 variants can identify critical binding determinants for rational drug design

  • Recombinant S1PR2 can be used to develop biophysical assays (such as thermal shift assays) to rapidly screen compound libraries for binding

Therapeutic Applications in Neurological Disorders:

  • Multiple Sclerosis:

    • Building on the success of fingolimod, more selective S1PR2 modulators could potentially provide improved efficacy with fewer side effects

    • S1PR2 antagonists might promote remyelination by blocking the inhibitory effects of S1PR2 on oligodendrocyte precursor migration and differentiation

  • Alzheimer's Disease:

    • S1PR2 modulators could be developed to reduce neuroinflammation and enhance clearance of amyloid-β

    • Following the promising results with fingolimod in AD models, more selective S1PR2-targeted compounds could potentially reduce Aβ generation and accumulation while enhancing astrocytic phagocytic activity

  • Parkinson's Disease:

    • Targeting S1PR2 could potentially protect dopaminergic neurons through various mechanisms:

      • Enhancing BDNF levels (as observed with fingolimod derivatives)

      • Activating protein phosphatase 2A

      • Reducing alpha-synuclein aggregation

      • Protecting against mitochondrial dysfunction

  • Huntington's Disease:

    • Given the altered expression of S1P-metabolizing enzymes in HD models, modulation of S1PR2 signaling could potentially address aspects of HD pathophysiology

    • Further research is needed to clarify the specific role of S1PR2 in HD pathogenesis

Delivery Strategies:

  • Development of blood-brain barrier (BBB)-penetrant S1PR2 modulators is crucial for targeting central nervous system disorders

  • Alternative delivery approaches, such as intranasal delivery or exosome-based delivery systems, could be explored for compounds with limited BBB permeability

  • Cell-specific targeting strategies could minimize off-target effects in non-neural tissues

The development of increasingly selective S1PR2 modulators, guided by research with recombinant proteins, holds promise for addressing multiple aspects of neurological disease pathophysiology, from inflammation to neurodegeneration and synaptic dysfunction.

What are the critical considerations for designing in vivo experiments to evaluate S1PR2-targeted therapies?

Designing effective in vivo experiments to evaluate S1PR2-targeted therapies requires careful consideration of several critical factors:

Model Selection and Validation:

Compound Characterization:

  • Thoroughly characterize the selectivity profile of the compound against all five S1P receptor subtypes

  • Determine the pharmacokinetic properties, including blood-brain barrier penetrance for CNS indications

  • Establish the effective dose range and administration schedule based on pharmacokinetic/pharmacodynamic (PK/PD) relationships

  • Confirm target engagement using biomarkers or ex vivo receptor occupancy studies

Experimental Design Considerations:

  • Include appropriate control groups (vehicle control, positive control with established efficacy when available)

  • Design adequately powered studies based on expected effect size and variability

  • Consider sex differences in S1PR2 expression and function

  • Plan for both acute and chronic treatment regimens to assess durability of effects

  • Include comprehensive behavioral and physiological assessments relevant to the disease model

  • Collect tissues for molecular and histological analyses to correlate with functional outcomes

Biomarker Development:

  • Identify and validate biomarkers of S1PR2 engagement and modulation

  • Develop translational biomarkers that can be used in both preclinical models and human studies

  • Consider using imaging techniques (PET, MRI) to monitor disease progression and treatment effects in vivo

  • Include pharmacodynamic markers specific to S1PR2 signaling pathways (e.g., Rho activation)

Safety Assessment:

  • Monitor for potential on-target adverse effects based on known S1PR2 functions in various tissues

  • Assess for potential immunomodulatory effects that might be detrimental in certain contexts

  • Consider potential developmental effects if the therapy might be used in pediatric populations

  • Evaluate effects on cardiovascular and auditory systems where S1PR2 has known important functions

By addressing these considerations in the experimental design, researchers can generate more robust and translatable data on the efficacy and safety of S1PR2-targeted therapies, potentially accelerating their development for clinical applications.

What are the common technical challenges in working with recombinant S1PR2 and how can they be overcome?

Researchers working with recombinant S1PR2 face several technical challenges due to its nature as a membrane-bound G-protein-coupled receptor. Here are the main challenges and recommended solutions:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for the expression system of choice

  • Solution: Use specialized expression vectors with strong promoters designed for membrane proteins

  • Solution: Consider fusion tags that enhance expression (e.g., BRIL, T4 lysozyme)

  • Solution: Test different cell lines to identify those with optimal expression characteristics

  • Solution: Implement temperature shifts during expression (e.g., lowering to 30°C after induction) to allow proper folding

Challenge 2: Protein Instability and Aggregation

  • Solution: Screen multiple detergents and lipid compositions for optimal solubilization and stability

  • Solution: Consider nanodiscs, amphipols, or styrene-maleic acid lipid particles (SMALPs) as alternatives to detergent micelles

  • Solution: Add cholesterol or specific lipids during purification to enhance stability

  • Solution: Introduce stabilizing mutations identified through alanine scanning or directed evolution approaches

  • Solution: Maintain strict temperature control during purification (typically 4°C)

Challenge 3: Functional Assessment Difficulties

  • Solution: Develop robust binding assays using labeled ligands with high affinity and selectivity

  • Solution: Implement cell-based functional assays that measure specific S1PR2 signaling pathways

  • Solution: Use conformational antibodies that recognize properly folded receptor

  • Solution: Employ thermostability assays (e.g., CPM thermal shift assays) to assess protein quality

  • Solution: Consider reconstitution into proteoliposomes for functional studies

Challenge 4: Post-translational Modification Issues

  • Solution: Choose expression systems capable of performing mammalian-like post-translational modifications

  • Solution: Identify and potentially mutate glycosylation sites that might cause heterogeneity

  • Solution: Consider enzymatic deglycosylation approaches if glycosylation causes problems

  • Solution: Monitor palmitoylation status, which can affect receptor function

Challenge 5: Structural Characterization Challenges

  • Solution: Consider fusion with crystallization chaperones like T4 lysozyme or BRIL

  • Solution: Use ligands (especially antagonists) during purification to stabilize specific conformations

  • Solution: For cryo-EM studies, optimize grid preparation conditions (detergent concentration, buffer composition)

  • Solution: Consider antibody fragments (Fab) to increase particle size and provide fiducial markers

  • Solution: Explore computational approaches to predict structure when experimental determination is challenging

By implementing these solutions, researchers can significantly improve their success in working with recombinant S1PR2, enabling more productive studies of this important receptor's structure, function, and potential as a therapeutic target.

How can researchers troubleshoot common problems in S1PR2 signaling assays?

Troubleshooting S1PR2 signaling assays requires systematic approaches to identify and resolve common issues:

Problem 1: Low Signal-to-Noise Ratio in Binding Assays

Potential Causes:

  • Insufficient receptor expression

  • Improper receptor folding

  • Ligand degradation

  • Non-specific binding

Solutions:

  • Verify receptor expression levels by western blot or flow cytometry

  • Optimize cell culture conditions (density, passage number, transfection efficiency)

  • Use fresh ligand preparations and verify ligand quality

  • Optimize wash steps and blocking conditions to reduce non-specific binding

  • Include positive controls with known high-affinity ligands

  • Increase signal amplification or use more sensitive detection methods

Problem 2: Inconsistent Results in Functional Assays

Potential Causes:

  • Receptor desensitization

  • Variation in receptor expression levels

  • Interference from endogenous receptors

  • Pathway crosstalk

Solutions:

  • Standardize cell density and passage number across experiments

  • Consider stable cell lines instead of transient transfections for more consistent expression

  • Use receptor subtype-selective antagonists to block contributions from other S1P receptors

  • Perform concentration-response curves rather than single concentrations

  • Include appropriate positive and negative controls in each experiment

  • Validate key findings with orthogonal assay methods

Problem 3: Difficulties Distinguishing S1PR2-Specific Effects

Potential Causes:

  • Expression of multiple S1P receptor subtypes

  • Overlapping signaling pathways

  • Compensatory mechanisms

Solutions:

  • Use CRISPR/Cas9 to generate receptor knockout cell lines

  • Employ siRNA knockdown of specific receptor subtypes

  • Utilize receptor subtype-selective pharmacological tools

  • Focus on pathways preferentially activated by S1PR2 (e.g., Rho/ROCK)

  • Perform parallel experiments in cells expressing only S1PR2 versus other subtypes

Problem 4: Poor Reproducibility of Results

Potential Causes:

  • Variation in cell culture conditions

  • Inconsistent reagent quality

  • Subtle differences in protocol execution

Solutions:

  • Develop detailed standard operating procedures (SOPs)

  • Use the same lot numbers for critical reagents when possible

  • Control for cell passage number and density

  • Standardize timing of treatments and measurements

  • Consider automation of critical steps to reduce operator variability

  • Include internal reference compounds in each experiment for normalization

Problem 5: Challenges in Detecting Rho/ROCK Pathway Activation

Potential Causes:

  • Transient nature of Rho activation

  • Sensitivity limitations of detection methods

  • Cell type-specific effects

Solutions:

  • Optimize time points for Rho activation measurement

  • Use FRET-based biosensors for real-time monitoring

  • Consider pull-down assays with GST-Rhotekin for direct measurement of active Rho

  • Assess downstream effects like stress fiber formation or phosphorylation of myosin light chain

  • Use positive controls known to activate Rho (e.g., lysophosphatidic acid)

What are the emerging research trends and unanswered questions in S1PR2 biology?

The field of S1PR2 biology is evolving rapidly, with several emerging research trends and critical unanswered questions that merit further investigation:

Emerging Research Trends:

  • Receptor Structure and Dynamics:

    • Application of cryo-electron microscopy to determine the structure of S1PR2 in different conformational states

    • Investigation of S1PR2 oligomerization and potential heterodimer formation with other GPCRs

    • Computational modeling of receptor dynamics and ligand interactions

  • Tissue-Specific Functions:

    • Increasing focus on cell type-specific roles of S1PR2 in different tissues

    • Growing interest in the role of S1PR2 in auditory function, given its association with deafness

    • Exploration of S1PR2 function in understudied tissues and developmental contexts

  • Pathological Mechanisms:

    • Expanding research on S1PR2's involvement in fibrotic diseases beyond established models

    • Emerging interest in S1PR2's role in metabolic disorders and cardiovascular diseases

    • Investigation of S1PR2 in cancer progression, particularly in relation to tumor microenvironment

  • Novel Modulators:

    • Development of biased ligands that selectively activate specific downstream pathways

    • Interest in allosteric modulators that may offer improved subtype selectivity

    • Exploration of natural products as sources of novel S1PR2 modulators

Critical Unanswered Questions:

  • Signaling Mechanisms:

    • How does S1PR2 coupling to different G proteins vary across cell types and contexts?

    • What are the molecular determinants of signaling bias at S1PR2?

    • How do post-translational modifications regulate S1PR2 function?

  • Physiological Roles:

    • What is the precise role of S1PR2 in neuronal function and neurodevelopment?

    • How does S1PR2 contribute to the regulation of blood-brain barrier integrity?

    • What is the significance of S1PR2 expression in immune cell subsets?

  • Pathological Implications:

    • What mechanisms underlie the apparently contradictory roles of S1PR2 in different disease contexts?

    • How does altered S1PR2 function specifically contribute to neurodegenerative processes?

    • Can targeting S1PR2 provide therapeutic benefits in conditions beyond those currently investigated?

  • Translational Questions:

    • What biomarkers can reliably indicate S1PR2 activity in vivo?

    • How can the therapeutic potential of S1PR2 modulation be maximized while minimizing adverse effects?

    • Is there potential for combining S1PR2 modulators with other therapeutic approaches for synergistic effects?

These emerging trends and unanswered questions highlight the dynamic nature of S1PR2 research and point to fruitful areas for future investigation that could significantly advance our understanding of this important receptor's biology and therapeutic potential.

How might advances in structural biology and computational approaches enhance our understanding of S1PR2?

Recent and anticipated advances in structural biology and computational approaches are poised to revolutionize our understanding of S1PR2 in several key ways:

Advances in Structural Biology:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of S1PR2 in multiple conformational states without crystallization

    • Allows study of S1PR2 in complex with various signaling partners (G-proteins, arrestins)

    • Facilitates structural determination in more native-like lipid environments

    • Resolution improvements continue to approach atomic-level detail for membrane proteins

  • Integrative Structural Biology:

    • Combination of multiple techniques (X-ray crystallography, cryo-EM, NMR, mass spectrometry)

    • Hydrogen-deuterium exchange mass spectrometry to map ligand-induced conformational changes

    • Single-particle fluorescence approaches to study receptor dynamics in real-time

    • Cross-linking mass spectrometry to identify interaction interfaces with signaling partners

  • Native Mass Spectrometry:

    • Analysis of intact S1PR2 complexes with ligands and lipids

    • Determination of stoichiometry and stability of complexes

    • Identification of endogenous ligands and post-translational modifications

Computational Approaches:

  • Advanced Molecular Dynamics Simulations:

    • Millisecond-scale simulations to capture complete conformational changes

    • Enhanced sampling methods to explore energy landscapes more efficiently

    • Integration of experimental data as restraints in simulations

    • Coarse-grained simulations to study receptor behavior in complex membrane environments

  • Artificial Intelligence and Machine Learning:

    • Prediction of protein-ligand binding affinities and modes

    • Virtual screening of large compound libraries with improved accuracy

    • Generation of novel ligand scaffolds using generative models

    • Prediction of functional outcomes of receptor mutations

  • Systems Biology Approaches:

    • Network analysis to understand S1PR2 signaling in the context of broader cellular pathways

    • Multi-scale modeling from molecular to cellular levels

    • Integration of -omics data to understand receptor regulation in different contexts

Anticipated Impacts on S1PR2 Research:

  • Structure-Based Drug Design:

    • Development of highly selective S1PR2 modulators based on detailed structural insights

    • Design of biased ligands that selectively activate specific downstream pathways

    • Identification of allosteric binding sites for novel modulatory approaches

  • Mechanistic Understanding:

    • Elucidation of the structural basis for G-protein coupling specificity

    • Understanding of how different ligands induce distinct conformational changes

    • Insights into the molecular mechanisms of receptor desensitization and internalization

  • Disease Relevance:

    • Structural understanding of disease-associated mutations

    • Modeling of receptor dynamics in different cellular contexts relevant to pathology

    • Prediction of drug responses in personalized medicine applications

  • Novel Therapeutic Strategies:

    • Design of peptide or antibody-based modulators targeting specific receptor epitopes

    • Development of degraders or proteolysis-targeting chimeras (PROTACs) for S1PR2

    • Structure-guided engineering of bispecific molecules targeting S1PR2 and other disease-relevant proteins

These advances in structural biology and computational approaches hold tremendous promise for enhancing our understanding of S1PR2 biology and accelerating the development of novel therapeutic strategies targeting this important receptor.

What are the key takeaways for researchers beginning work with recombinant S1PR2?

For researchers beginning work with recombinant S1PR2, several key considerations will help ensure successful experimental outcomes:

Fundamental Understanding:

  • Appreciate that S1PR2 is a G-protein-coupled receptor with unique signaling properties distinct from other S1P receptor subtypes

  • Recognize its involvement in diverse physiological processes and pathological conditions, particularly in the nervous system, immune function, and vascular biology

  • Understand that S1PR2 primarily couples to G12/13 proteins leading to Rho activation, but can also signal through other G-protein subtypes depending on cellular context

Technical Considerations:

  • Expect challenges in expression and purification due to S1PR2's nature as a membrane protein

  • Select appropriate expression systems (mammalian or insect cells) that allow proper folding and post-translational modifications

  • Optimize construct design with purification tags and potential stabilizing modifications

  • Be prepared to screen multiple detergents and lipid compositions for optimal protein stability

  • Consider alternative membrane mimetics such as nanodiscs or amphipols for functional studies

Experimental Design:

  • Include appropriate controls in all experiments, particularly positive controls with known S1PR2 ligands

  • Use multiple complementary approaches to validate key findings

  • Consider potential confounding factors such as expression of endogenous S1P receptors in cell-based assays

  • Develop robust and reproducible assays specific for S1PR2 signaling pathways

  • Be aware of potential species differences when translating between model systems

Available Tools:

  • Utilize published pharmacological tools including selective agonists and antagonists

  • Consider genetic approaches (CRISPR/Cas9, siRNA) to complement pharmacological experiments

  • Take advantage of available antibodies, labeled ligands, and reporter constructs

  • Explore computational resources for structure prediction and ligand docking

Strategic Approach:

  • Begin with well-established protocols before attempting novel methodologies

  • Collaborate with experienced membrane protein biochemists when possible

  • Design a systematic research plan with clear milestones and decision points

  • Stay informed about the rapidly evolving field through recent literature

  • Consider how your specific research questions align with current knowledge gaps

By keeping these key considerations in mind, researchers new to S1PR2 research can establish a solid foundation for their studies and contribute meaningfully to this important and expanding field.

How should researchers integrate findings from S1PR2 studies into broader sphingolipid signaling research?

Integrating S1PR2 findings into the broader context of sphingolipid signaling requires thoughtful approaches that recognize the interconnected nature of these pathways:

Conceptual Integration:

  • Position S1PR2 within the larger sphingolipid metabolic network, recognizing that S1P production, degradation, and receptor signaling are highly interconnected

  • Consider that alterations in S1PR2 signaling may affect or be affected by changes in sphingolipid metabolism more broadly

  • Recognize the potential for coordinated regulation across multiple S1P receptors and other sphingolipid-responsive elements

Methodological Integration:

  • Measure multiple sphingolipid species and metabolites when studying S1PR2 function using lipidomic approaches

  • Consider parallel analysis of multiple S1P receptors to identify subtype-specific versus shared effects

  • Examine both receptor-mediated and direct intracellular effects of sphingolipid metabolites

  • Use systems biology approaches to model the complex interactions within sphingolipid signaling networks

Interpretation of Results:

  • Distinguish between primary effects of S1PR2 modulation and secondary consequences due to altered sphingolipid metabolism

  • Consider compensation by other sphingolipid signaling components when S1PR2 is inhibited or deleted

  • Interpret tissue-specific findings in the context of the local sphingolipid environment and receptor expression patterns

  • Evaluate contradictory findings in light of the complex interplay between different sphingolipid signaling elements

Translational Considerations:

  • Recognize that therapeutic targeting of S1PR2 may have ripple effects throughout sphingolipid metabolism

  • Consider combination approaches targeting both S1PR2 and complementary aspects of sphingolipid signaling

  • Develop biomarkers that capture changes in the broader sphingolipid network, not just direct S1PR2 signaling

  • Anticipate potential adverse effects based on known roles of other sphingolipid signaling components

Future Research Directions:

  • Design studies that specifically address the interplay between S1PR2 and other sphingolipid signaling elements

  • Develop more sophisticated models incorporating multiple components of sphingolipid metabolism and signaling

  • Investigate potential crosstalk between S1PR2 and other lipid signaling pathways

  • Explore how perturbations in sphingolipid metabolism affect S1PR2 expression, localization, and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.