Recombinant Human Sphingosine 1-phosphate receptor 4 (S1PR4)

Shipped with Ice Packs
In Stock

Description

Genomic Organization and Expression

While other sphingosine 1-phosphate receptors demonstrate widespread expression throughout various tissues, S1PR4 exhibits a more restricted expression pattern primarily in lymphoid tissues and cells of the immune system . This specialized distribution pattern suggests S1PR4 may have evolved to perform specific functions in immune regulation rather than participating in broader physiological processes that involve other S1P receptors.

S1PR4 is abundantly expressed in diverse immune cell populations, including T cells, B cells, and dendritic cells, with each cell type potentially utilizing this receptor for specific immunological functions . Recent research has additionally identified S1PR4 expression in lung tissues, expanding our understanding of its potential physiological roles beyond purely immunological contexts . The selective expression profile of S1PR4 makes it particularly attractive as a therapeutic target for immune modulation with potentially reduced off-target effects compared to broader-spectrum S1P receptor modulators.

Table 2: Species Comparison of S1PR4

SpeciesTransmembrane DomainsAmino AcidsChromosomal LocationGene Symbol
Human738419p13.3S1PR4
Mouse738610 C1S1pr4
Rat74137q11S1pr4

G Protein Coupling and Downstream Pathways

S1PR4 demonstrates selective coupling to specific G protein subtypes, primarily engaging with Gαi and Gα12/13 proteins but not with Gαq, Gα15/16, or Gαs . The coupling to Gαi triggers inhibition of adenylyl cyclase activity, resulting in decreased intracellular cyclic adenosine monophosphate (cAMP) levels, a pathway that can be specifically blocked by pertussis toxin . Additionally, the βγ subunits released from activated Gαi proteins stimulate phospholipase C activity, leading to increased cytosolic calcium concentrations that influence various cellular processes .

Signaling through Gα12/13 activates the small GTPase RhoA and its downstream effector Rho-associated protein kinase (ROCK), a pathway critical for regulating cytoskeletal reorganization and cell migration . S1PR4 activation has also been demonstrated to trigger extracellular signal-regulated kinase (ERK1/2) phosphorylation, involving tyrosine phosphorylation of human epidermal growth factor receptor 2 (HER2) . Furthermore, S1PR4 signaling can activate the small GTPase Cdc42, further contributing to its effects on cytoskeletal dynamics and cellular morphology .

Table 3: G Protein Coupling of S1PR4

G ProteinCouplingDownstream Effect
Gαi/GαoYesAdenylyl cyclase inhibition
Gα12/Gα13YesActivation of Cdc42
GαqNo-
Gα15/Gα16No-
GαsNo-

Ligand Recognition and Receptor Activation

The primary endogenous ligand for S1PR4 is sphingosine-1-phosphate (S1P), which binds with high affinity to the receptor . Other lipid mediators, including dihydrosphingosine-1-phosphate and sphingosylphosphorylcholine, can also activate S1PR4, although with lower potency compared to S1P . The rank order of potency for these endogenous ligands has been established as: sphingosine-1-phosphate > dihydrosphingosine-1-phosphate .

Recent structural studies have provided detailed molecular insights into the mechanism of ligand recognition by S1PR4. The cryo-EM structures of apo-S1PR4 and S1P-bound S1PR4 in complex with Gαi reveal the specific interactions involved in ligand binding and the conformational changes that lead to receptor activation . These structures demonstrate that S1P binding induces specific rearrangements in the transmembrane helices, particularly affecting the positions of transmembrane helices 3, 6, and 7, which ultimately facilitate G protein coupling and activation .

Table 4: Endogenous Ligands of S1PR4

LigandRelative PotencyNotes
Sphingosine 1-phosphateHighPrimary endogenous ligand
Dihydrosphingosine 1-phosphateMediumLess potent than S1P
SphingosylphosphorylcholineLowExhibits reduced potency compared to S1P

Role in Immune Cell Regulation

S1PR4 plays multifaceted roles in immune cell regulation, affecting various aspects of immune function including cell differentiation, activation, and cytokine production. In plasmacytoid dendritic cells (pDCs), S1PR4 signaling prevents the activation-induced internalization of the inhibitory receptor leukocyte immunoglobulin-like transcript (ILT7) . This mechanism, which operates through the RhoA-ROCK pathway, helps maintain pDC responsiveness to environmental cues and modulates their function in orchestrating immune responses .

Research has also implicated S1PR4 in neutrophil biology, with studies showing that neutrophils upregulate S1PR4 expression upon stimulation . This observation suggests that sphingosine-1-phosphate may regulate various aspects of neutrophil function through engagement with this receptor, potentially influencing processes such as degranulation, reactive oxygen species production, and neutrophil extracellular trap formation, although these specific effects require further characterization .

S1PR4 additionally modulates T cell functions, with studies demonstrating that while its role in T cell migration appears secondary to that of S1PR1, S1PR4 significantly affects T cell proliferation and cytokine production . Loss-of-function studies have revealed that absence of S1PR4 leads to mild enhancement of both CD4+ and CD8+ T cell proliferation, suggesting that S1PR4 normally exerts a restraining influence on T cell activation and expansion .

Impact on Cell Migration and Trafficking

The contribution of S1PR4 to immune cell migration and trafficking demonstrates complex and sometimes contradictory patterns across different cell types. Several studies suggest that S1PR4 may negatively regulate lymphocyte migration, as loss of S1PR4 resulted in modestly enhanced migration of CD4+ and CD8+ T cells in experimental settings, with these findings confirmed for CD8+ T cells in vivo . These observations suggest that S1PR4 may counterbalance the pro-migratory effects of other sphingosine-1-phosphate receptors, particularly S1PR1.

S1PR4 appears to play a particularly significant role in dendritic cell (DC) trafficking patterns. In a model of allergic airway disease, genetic deletion of S1PR4 caused marked accumulation of DCs in lymph nodes . This phenomenon could be explained by several potential mechanisms, including altered expression of chemokine receptors like CCR7, which drives DC migration to lymph nodes, or through interactions with other S1P receptors that undergo dynamic regulation during DC activation, such as the upregulation of S1PR1 and downregulation of S1PR2 .

Some investigations have suggested a functional interdependence between S1PR4 and S1PR1 in regulating cellular migration. This concept has emerged from observations in both murine T cell lines and human B cell lines, where the two receptors may physically associate and modulate each other's signaling capabilities . Such interactions could provide sophisticated mechanisms for fine-tuning migratory responses of immune cells to sphingosine-1-phosphate gradients in different tissue microenvironments.

Insights into Receptor Activation Mechanisms

A key finding from these structural studies is the identification of the precise G protein binding interface, which involves polar residues D350 and C351 of Gαi and the surrounding polar residues R143 (in transmembrane helix 3) and R79 (in intracellular loop 1) of S1PR4 . The structures further reveal altered G protein binding patterns between the apo and ligand-bound receptor states, attributed to the repositioning of Gαi upon receptor activation following ligand binding .

These structural insights provide invaluable information for understanding the molecular basis of S1PR4 function and offer templates for the development of selective S1PR4 agonists with improved specificity and safety profiles . The researchers note that since S1PR4 expression is restricted to lung and lymphoid cells, therapeutic agents specifically targeting S1PR4 might avoid triggering side effects associated with modulation of more widely expressed S1P receptors .

Expression Systems and Purification Methods

Production of recombinant human S1PR4 for research and therapeutic applications typically involves heterologous expression systems followed by purification using various chromatographic techniques. Mammalian cell lines such as HEK293 and CHO cells represent common expression platforms for S1PR4, as they provide the necessary post-translational modifications and membrane environment for proper receptor folding and function .

For structural biology applications, researchers implement specialized strategies to optimize the expression and stability of recombinant S1PR4. These approaches include incorporating fusion partners or affinity tags to facilitate detection and purification, as well as utilizing detergents or lipid nanodiscs to maintain the receptor in a native-like membrane environment . The AlphaFold-predicted structure of human S1PR4 has also served as a valuable template for designing expression constructs with improved stability characteristics .

Commercial sources now provide recombinant human S1PR4 protein for research purposes, with companies like MyBioSource.com offering human S1PR4/Sphingosine 1-Phosphate Receptor 4 recombinant protein at a price point of $405.00 . These commercially available preparations provide convenient access to purified receptor protein for researchers investigating S1PR4 functions, developing screening assays, or identifying novel modulators of this receptor.

Research and Therapeutic Applications

Recombinant human S1PR4 serves multiple applications spanning basic research and drug discovery initiatives. In fundamental research contexts, purified S1PR4 protein enables biochemical and biophysical characterization of receptor properties, including detailed studies of ligand binding kinetics, conformational dynamics, and interactions with various signaling partners. The protein also serves as an important antigen for generating specific antibodies against S1PR4, which become crucial reagents for detecting and quantifying the receptor in biological samples.

In pharmaceutical research and development, recombinant S1PR4 forms the foundation for high-throughput screening campaigns aimed at identifying novel receptor modulators. These screening platforms typically employ assays measuring ligand binding affinities, G protein activation efficiencies, downstream signaling responses, or conformational changes in the receptor. The availability of high-resolution structural information for S1PR4 further enables structure-based drug design approaches, including virtual screening and rational design of selective agonists or antagonists with improved specificity profiles.

Additionally, recombinant S1PR4 can be incorporated into reconstituted biochemical systems or cell-based assays for evaluating the functional consequences of specific mutations or post-translational modifications. Such studies provide critical insights into the molecular determinants of receptor function and regulation, as well as the potential effects of genetic variants associated with disease susceptibility or differential drug responses.

S1PR4 as a Drug Target

S1PR4 represents an attractive therapeutic target for intervention in various immune-mediated disorders, with its restricted expression pattern suggesting that selective modulators might achieve immunomodulation with fewer systemic side effects compared to less selective sphingosine-1-phosphate receptor modulators . Several lines of evidence support the therapeutic potential of targeting S1PR4 in various disease contexts.

The involvement of S1PR4 in immune cell differentiation, activation, and trafficking suggests that modulation of this receptor could influence immune responses in conditions such as autoimmune diseases, inflammatory disorders, and transplant rejection scenarios . The recent structural characterization of S1PR4 provides valuable templates for the rational development of selective S1PR4 agonists with improved specificity and safety profiles compared to broader-spectrum sphingolipid receptor modulators .

The development of S1PR4-specific modulators represents an important frontier in sphingosine-1-phosphate receptor pharmacology. While several S1P receptor-targeting drugs are currently in clinical use or development, most of these compounds interact with multiple S1P receptor subtypes, particularly S1PR1, which demonstrates widespread expression throughout various body tissues. Selective S1PR4 modulators could potentially offer more targeted immunomodulation with reduced off-target effects on cardiovascular, neurological, or other systems where other S1P receptors play predominant roles.

Current Challenges and Opportunities

Despite significant therapeutic potential, several challenges must be addressed in developing effective S1PR4-targeted therapies. A primary challenge involves achieving high selectivity for S1PR4 over other sphingosine-1-phosphate receptor subtypes, which share structural similarities in their ligand-binding domains. The recently determined structural data for S1PR4 should facilitate the design of selective modulators by highlighting unique features of the S1PR4 binding pocket that can be exploited for targeted drug design .

Another significant challenge emerges from the complex and sometimes seemingly contradictory roles of S1PR4 in different immune cell populations and physiological contexts. While S1PR4 may negatively regulate T cell proliferation and migration in certain settings, its effects on dendritic cell trafficking and plasmacytoid dendritic cell activation suggest more nuanced roles in immune regulation . Additional research is necessary to fully elucidate the cell type-specific functions of S1PR4 and accurately predict the integrated effects of S1PR4 modulation in different disease states.

Promising opportunities for future investigation include detailed characterization of S1PR4 expression and function in specific disease contexts, development of improved cellular and animal models for studying S1PR4 biology, and design of selective pharmacological tools to precisely probe S1PR4 function. The availability of high-resolution structural data also creates possibilities for structure-function studies to identify key residues involved in ligand recognition, G protein coupling, and receptor activation mechanisms, which could inform the design of novel therapeutic agents targeting this receptor.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special format requests. Please indicate your preference in the order notes section, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize its development.
Synonyms
S1PR4; EDG6; Sphingosine 1-phosphate receptor 4; S1P receptor 4; S1P4; Endothelial differentiation G-protein coupled receptor 6; Sphingosine 1-phosphate receptor Edg-6; S1P receptor Edg-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS FRGSRSLSFRMREPLSSISSVRSI
Uniprot No.

Target Background

Function
Sphingosine 1-phosphate receptor 4 (S1PR4) is a receptor for the bioactive lysophospholipid sphingosine 1-phosphate (S1P). S1P exerts diverse physiological effects on a wide range of cells and tissues. S1PR4 may play a role in cell migration processes specific to lymphocytes.
Gene References Into Functions
  1. High S1PR4 expression is associated with anti-neutrophil cytoplasmic antibody-associated vasculitis. PMID: 28206609
  2. S1PR4 missense mutation is associated with variant blood cell traits. PMID: 27399967
  3. Shear stress did not induce rapid dephosphorylation of beta-arrestin-1 or rapid internalization of S1P3, indicating no GPCR activation. These findings suggest that Galphaq/11 participates in the sensing/transducing of shear stress independently of GPCR activation in ECs. PMID: 28148497
  4. Ig-like transcript 7 is rapidly internalized upon receptor-mediated endocytosis of TLR7/9 ligands to allow high IFN-alpha production. This is antagonized by S1PR4 signaling, thus decreasing TLR-induced IFN-alpha secretion. PMID: 26783340
  5. S1P2 translocation to the nucleus is regulated by an autocrine loop involving S1P and S1P4. In contrast, the translocation of Y416 phosphorylated c-Src to the nucleus appears to be regulated by a mechanism that does not involve S1P3 or S1P4. PMID: 24486401
  6. Analysis of novel potent and selective sphingosine-1-phosphate 4 receptor (S1P-R) agonists PMID: 22119461
  7. Findings highlight an important role for S1P(4) and SK1 in ER(-) breast cancer progression. PMID: 22460268
  8. Data show that S1P4 uses HER2 to regulate extracellular signal regulated kinase-1/2 MDA-MB-453 breast cancer cells. PMID: 20837468
  9. Data report that sphingosine 1-phosphate receptor 4 (S1P(4)) is specifically up-regulated during the development of human megakaryocytes from progenitor cells PMID: 20686109
  10. Mutation of the ligand selectivity residue from glutamic acid to glutamine confers lysophosphatidic acid sensitivity with preference for short-chain species PMID: 15298705
  11. FOXO1 controls the expression of L-selectin and EDG1 and EDG6, receptors that regulate lymphocyte trafficking PMID: 18713968
Database Links

HGNC: 3170

OMIM: 603751

KEGG: hsa:8698

STRING: 9606.ENSP00000246115

UniGene: Hs.662006

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in fetal and adult lymphoid and hematopoietic tissue as well as in lung. Considerable level of expression in adult and fetal spleen as well as adult peripheral leukocytes and lung. Lower expression in adult thymus, lymph node, bone

Q&A

What is Sphingosine 1-phosphate receptor 4 (S1PR4) and what are its primary functions in immune modulation?

Sphingosine 1-phosphate receptor 4 (S1PR4) is a G protein-coupled receptor that plays critical roles in immune regulation by connecting innate and adaptive immune responses. S1PR4 mediates early immune modulation by neutrophils and facilitates the initial recruitment of circulating lymphocytes to sites of inflammation. The receptor is deliberately downregulated in germinal center regions while being highly expressed throughout other activated lymph node areas . S1PR4 primarily functions by:

  • Regulating neutrophil mobilization and trafficking during inflammatory responses

  • Facilitating proper draining lymph node (dLN) expansion and vascularization

  • Contributing to optimal germinal center (GC) development during adaptive immune responses

  • Modulating T cell cytotoxicity, particularly in CX3CR1+CD8+ T cell subsets

Research has revealed that S1PR4's immunomodulatory effects are context-dependent, varying based on specific cell populations involved and environmental signals present within particular experimental models .

How is S1PR4 expression distributed across different immune cell populations?

S1PR4 shows distinctive expression patterns across immune cell populations, providing insight into its specialized functions. In lymph nodes, S1PR4 mRNA is highly expressed throughout activated draining lymph nodes (dLN) but notably absent in germinal center regions, suggesting deliberate downregulation during B cell maturation .

At the cellular level, single-cell analysis reveals that S1PR4 is predominantly expressed in a specialized subset of CX3CR1+CD8+ T cells. This observation is particularly significant as CX3CR1+CD8+ T cells demonstrate the highest cytotoxicity profiles among CD8+ T cells . This expression pattern helps explain why S1PR4 expression positively correlates with CD8+ T cell cytotoxicity markers, including IFNG and GZMB, at both the mRNA and protein levels .

Additionally, myeloid lineage cells, particularly neutrophils, express functional S1PR4, which mediates their mobilization and tissue recruitment following immune challenges. This expression pattern across both innate and adaptive immune compartments positions S1PR4 as a critical connector between early inflammatory responses and subsequent adaptive immunity .

What experimental models are available for studying S1PR4 function?

Several experimental models have proven valuable for investigating S1PR4 biology across different immune contexts:

S1PR4 Knockout Mouse Models: S1PR4-deficient (S1PR4-/-) mice represent the gold standard for studying the receptor's physiological functions. These models allow researchers to examine S1PR4's role in normal immune development and during immune challenges. Key experiments utilize:

  • TH1 footpad immunization models to study localized inflammation and draining lymph node responses

  • Adoptive transfer experiments comparing wild-type and S1PR4-/- splenocytes to determine cell-intrinsic versus cell-extrinsic roles

  • Anti-Ly6G antibody-mediated neutrophil depletion studies to assess neutrophil-dependent inflammation pathways

Cell-Based Systems:

  • Flow cytometry and cell sorting to isolate S1PR4-expressing cell populations

  • CAR-T cell models to evaluate S1PR4's role in T cell function during immunotherapy

  • S1PR4 inhibitor/agonist treatment studies to manipulate receptor signaling

Clinical Validation Models:

  • Patient tissue samples for immunohistochemistry (IHC) and immunofluorescence (IF) validation

  • Correlation studies between S1PR4 expression and clinical outcomes in cancer patients

These complementary approaches allow researchers to dissect S1PR4 functions from molecular signaling to physiological immune responses.

What are the primary phenotypic changes observed in S1PR4-deficient models?

S1PR4-deficient models exhibit multiple phenotypic alterations affecting both innate and adaptive immune responses. The primary observable changes include:

Neutrophil Mobilization Defects:

  • Impaired neutrophil recruitment to inflammatory sites following immunization

  • Reduced neutrophil counts in blood after immune challenge

  • Diminished infiltration into footpad tissue in TH1 inflammation models

Lymph Node Development Abnormalities:

  • Severely attenuated draining lymph node (dLN) hypertrophy

  • Underdeveloped vascular network within dLN

  • Reduced expression of leukocyte tethering ligand (PNAd) in high endothelial venule regions

  • Impaired lymphocyte recruitment to dLN during inflammation

Germinal Center Deficiencies:

  • Formation of fewer and smaller germinal centers

  • Attenuated germinal center activation pathways

  • Reduced seeding of antigen-respondent lymphocytes into dLN

Interestingly, adoptive transfer experiments demonstrated that the lymphocyte recruitment defects in S1PR4-deficient mice were not due to lymphocyte-intrinsic abnormalities but instead reflected changes in the host environment. This suggests S1PR4's primary effects may operate through innate immune cells that subsequently influence adaptive immune responses .

How does S1PR4 signaling differ from other S1P receptors, and what experimental approaches can distinguish these pathways?

S1PR4 possesses unique signaling characteristics that distinguish it from other S1P receptors (S1PR1-5). Understanding these differences requires specialized experimental approaches:

Differential Signaling Pathway Analysis:
To distinguish S1PR4-specific signaling from other S1P receptors, researchers can employ:

  • Receptor-selective pharmacological tools:

    • S1PR4-specific agonists and antagonists in comparison with broader S1P modulators

    • Monitoring differential activation of downstream G protein effectors (Gαi vs. Gα12/13)

  • Phosphoproteomic profiling to identify unique S1PR4 signaling nodes:

    • Time-course analysis following selective receptor activation

    • Comparison of phosphorylation events across different immune cell subsets

  • Transcriptional response analysis:

    • RNA-sequencing of sorted cell populations from S1PR4-/- vs. other S1PR-deficient models

    • Identification of receptor-specific gene signatures in response to S1P stimulation

These approaches help delineate the unique contributions of S1PR4 to immune cell function and development, particularly in contexts where multiple S1P receptors are expressed simultaneously.

What methodological considerations are important when using recombinant human S1PR4 in functional studies?

When utilizing recombinant human S1PR4 for functional studies, researchers should consider several methodological factors to ensure reliable and reproducible results:

Protein Preparation and Quality Control:

  • Expression system selection (mammalian vs. insect cells) affects post-translational modifications critical for receptor function

  • Detergent selection for membrane protein solubilization impacts receptor stability and ligand binding

  • Verification of proper folding through ligand binding assays

  • Assessment of glycosylation status, which may affect receptor trafficking and signaling

Experimental Design Considerations:

  • Cell-based assays should include appropriate positive and negative controls:

    • Comparison with endogenous receptor behavior

    • Inclusion of function-blocking antibodies to confirm specificity

    • Use of S1PR4-/- cells as negative controls

  • For reconstitution experiments in S1PR4-deficient systems:

    • Titration of recombinant protein to identify physiologically relevant concentrations

    • Time-course studies to determine optimal exposure periods

    • Validation that exogenous S1PR4 recapitulates physiological signaling pathways

  • When studying receptor-ligand interactions:

    • Selection of appropriate S1P concentration ranges (nanomolar for physiological relevance)

    • Consideration of local S1P gradients that occur in tissues

    • Accounting for potential receptor desensitization with prolonged exposure

These methodological considerations help ensure that findings with recombinant S1PR4 accurately reflect the receptor's physiological functions in immune regulation.

How does S1PR4 mediate crosstalk between neutrophils and adaptive immune responses?

S1PR4 functions as a critical bridge between early neutrophil responses and subsequent adaptive immunity through several interconnected mechanisms:

Neutrophil-Driven Vascular Remodeling:
S1PR4 expression on neutrophils appears essential for their proper mobilization to inflammatory sites following immunization. Studies demonstrate that S1PR4-deficient mice show impaired neutrophil infiltration into footpad tissue during TH1 inflammation models. This defect diminishes the local vascular changes necessary for redirecting circulating lymphocytes toward inflamed regions .

Neutrophil-Dependent Lymphocyte Recruitment:
Experimental evidence has established a causal relationship between neutrophil activity and lymphocyte trafficking:

  • Neutrophil depletion with anti-Ly6G antibodies significantly reduces:

    • Early tissue edema

    • Redirection of naïve lymphocytes to draining lymph nodes (dLN) in wild-type mice

    • These effects are less prominent or absent in S1PR4-/- mice

  • Adoptive transfer experiments revealed:

    • Lymphocyte homing deficiencies in S1PR4-/- mice are not intrinsic to lymphocytes

    • Instead, they reflect alterations in the S1PR4-deficient host environment

    • Both wild-type and S1PR4-/- donor cells show comparable homing patterns when transferred into the same recipient

Feed-Forward Mechanisms Supporting Adaptive Immunity:
S1PR4-mediated neutrophil activity initiates a cascade that supports optimal adaptive immune responses:

  • Initial neutrophil signals promote:

    • Vascular remodeling in draining tissues

    • Enhanced circulation patterns toward dLN

    • Increased expression of leukocyte tethering ligands (PNAd) in high endothelial venules

  • These changes facilitate:

    • Improved seeding of antigen-responsive lymphocytes into dLN

    • Enhanced dLN hypertrophy

    • Optimal germinal center formation and activation pathways

This neutrophil-adaptive immune crosstalk mediated by S1PR4 demonstrates how innate immune signals can program the subsequent quality and magnitude of adaptive responses.

What is the role of S1PR4 in cancer immunotherapy, and how can it be experimentally targeted?

S1PR4 has emerged as a promising immunotherapeutic target based on its significant associations with anti-tumor immunity and favorable cancer outcomes:

Mechanisms in Anti-Tumor Immunity:
S1PR4 appears to enhance anti-tumor immunity through several mechanisms:

  • CD8+ T cell activity:

    • S1PR4 expression is highest in CX3CR1+CD8+ T cells, which demonstrate superior cytotoxicity

    • Positive correlation between S1PR4 levels and cytotoxicity markers (IFNG, GZMB)

    • Association with increased CD8+ T cell infiltration into tumors

  • Tertiary lymphoid structure (TLS) formation:

    • S1PR4 expression significantly correlates with TLS signatures, including CXCL13

    • TLS are critical for generating and sustaining anti-tumor immune responses within the tumor microenvironment

Experimental Approaches for Targeting S1PR4:
Researchers can modulate S1PR4 activity in experimental immunotherapy settings through:

  • Pharmacological modulation:

    • S1PR4-specific agonists to enhance T cell cytotoxicity

    • Testing combinations with established immunotherapies (checkpoint inhibitors)

    • Monitoring effects on immune cell migration and function

  • CAR-T cell engineering:

    • Upregulation of S1PR4 in engineered T cells may enhance their anti-tumor function

    • Evaluation of persistence, trafficking, and cytotoxicity of S1PR4-modulated CAR-T cells

  • Genetic approaches:

    • CRISPR-based modulation of S1PR4 expression in adoptively transferred T cells

    • Generation of S1PR4-overexpressing immune cells for improved tumor targeting

These experimental strategies leverage S1PR4's immunomodulatory properties to potentially enhance cancer immunotherapeutic approaches.

What technical challenges exist in studying S1PR4 biology, and how can researchers address them?

Investigating S1PR4 biology presents several technical challenges that researchers must navigate to obtain reliable results:

Receptor Expression and Purification Issues:

  • Membrane protein instability during isolation

  • Low expression levels in certain cell types

  • Post-translational modifications affecting function

Solutions:

  • Utilize codon-optimized expression systems

  • Develop stabilized receptor constructs

  • Employ detergent screening to identify optimal solubilization conditions

  • Consider nanobody-based approaches to stabilize native conformations

Context-Dependent Functions:
S1PR4's effects vary significantly depending on:

  • Cell type (neutrophils vs. T cells vs. dendritic cells)

  • Disease model (inflammatory conditions vs. cancer)

  • Existing inflammatory state (steady state vs. activated)

Solutions:

  • Design experiments with appropriate controls for cellular context

  • Use cell-type specific conditional knockout models

  • Compare results across multiple disease models

  • Perform time-course studies to capture dynamic changes

Confounding Effects from Other S1P Receptors:

  • Overlapping expression patterns with other S1PRs

  • Potential compensatory mechanisms in knockout models

  • Lack of highly specific pharmacological tools

Solutions:

  • Use receptor-selective agonists/antagonists when available

  • Employ combinatorial knockout approaches

  • Apply CRISPR-based techniques for precise receptor modulation

  • Conduct comprehensive S1PR expression profiling alongside functional studies

Translational Challenges:

  • Species differences between mouse models and human systems

  • Variability in receptor expression among patient populations

  • Complex integration with other immune signaling pathways

Solutions:

  • Validate findings in humanized mouse models

  • Correlate experimental results with patient data

  • Stratify analyses based on receptor expression levels

  • Integrate multi-omics approaches to capture system-wide effects

By addressing these technical challenges, researchers can develop more robust approaches to studying S1PR4 biology and its potential therapeutic applications.

How can researchers effectively use S1PR4 as a biomarker in cancer immunology studies?

S1PR4 shows significant potential as a biomarker in cancer immunology based on its strong correlations with favorable immune parameters and clinical outcomes:

Methodological Approaches:

  • Immunohistochemistry (IHC) and Immunofluorescence (IF):

    • Validated protocols have established S1PR4 protein detection in HNSCC tissues

    • Combination with CD8 staining provides information on both receptor expression and T cell infiltration

    • Quantitative analysis allows correlation with clinical outcomes

  • Gene Expression Analysis:

    • S1PR4 mRNA levels can be assessed via RT-PCR or RNA-seq

    • Integration with immune signature genes enhances predictive power

    • Correlation with CD8+ T cell markers (CD8A, CD8B) and cytotoxicity markers (IFNG, GZMB)

  • Multiparameter Analysis:

    • Combined assessment with other GPCR biomarkers (S1PR5, GPR87)

    • Integration with established immune scoring systems

    • Incorporation into machine learning models for improved patient stratification

Applications in Research:

  • Patient stratification for clinical trials of immunotherapies

  • Monitoring changes in tumor immune microenvironment during treatment

  • Identification of potential responders to immune checkpoint inhibitors

  • Combination with tertiary lymphoid structure (TLS) markers for comprehensive immune assessment

The validated association between S1PR4 expression and favorable tumor immune microenvironment makes it a valuable biomarker for both prognostic assessment and therapeutic decision-making in cancer immunology research.

What emerging technologies are advancing our understanding of S1PR4 signaling dynamics?

Several cutting-edge technologies are transforming our ability to understand S1PR4 signaling dynamics with unprecedented precision:

Single-Cell Multi-omics Approaches:

  • Single-cell RNA sequencing has already revealed that S1PR4 is predominantly expressed in CX3CR1+CD8+ T cells among T cell populations

  • Integration of single-cell proteomics with transcriptomics can reveal post-transcriptional regulation

  • Spatial transcriptomics techniques allow mapping of S1PR4-expressing cells within complex tissue architectures

Live Cell Signaling Reporters:

  • FRET-based biosensors for real-time monitoring of S1PR4 activation

  • Optogenetic tools to precisely control S1PR4 signaling with spatial and temporal resolution

  • Calcium flux assays to monitor immediate receptor activation in different cell types

Computational Biology Approaches:

  • Machine learning classification has successfully identified S1PR4 as a key determinant of HNSCC molecular subtypes with distinct prognoses

  • Network analysis algorithms can map S1PR4 interactions within broader immune signaling networks

  • Systems biology models integrating transcriptomic and proteomic data can predict S1PR4's impact on immune cell function

Advanced Imaging Technologies:

  • Super-resolution microscopy to visualize S1PR4 clustering and membrane organization

  • Intravital microscopy for tracking S1PR4-dependent cell migration and interactions in vivo

  • Mass cytometry (CyTOF) for high-dimensional characterization of S1PR4-expressing cell populations

These technologies collectively provide a multi-dimensional view of S1PR4 biology, from molecular interactions to cellular functions and tissue-level effects. Their application is revealing new insights into how this receptor coordinates immune responses across different contexts.

How can researchers distinguish between direct and indirect effects of S1PR4 modulation in experimental systems?

Distinguishing direct versus indirect effects of S1PR4 modulation represents a significant challenge in experimental systems. Several methodological approaches can help researchers address this complexity:

Temporal Analysis of Signaling Events:

  • Time-course experiments to establish sequence of cellular responses following S1PR4 activation

  • Immediate early gene expression analysis to identify primary transcriptional targets

  • Kinetic analysis of phosphorylation cascades to map direct signaling events

Cell-Type Specific Manipulation:

  • Conditional knockout models targeting S1PR4 in specific cell lineages:

    • Neutrophil-specific deletion to isolate myeloid effects

    • T cell-specific deletion to focus on adaptive immune functions

    • Comparison of phenotypes reveals cell-autonomous versus non-autonomous effects

  • Adoptive transfer experiments:

    • Transfer of wild-type cells into S1PR4-/- hosts

    • Transfer of S1PR4-/- cells into wild-type hosts

    • These approaches have successfully demonstrated that lymphocyte recruitment defects in S1PR4-/- mice are due to host environment alterations rather than intrinsic lymphocyte abnormalities

Pharmacological Approaches:

  • Short-term versus long-term receptor modulation:

    • Acute treatment with specific agonists/antagonists reveals immediate effects

    • Chronic treatment allows assessment of compensatory mechanisms

    • Comparison helps distinguish direct signaling from adaptive responses

  • Selective inhibition of downstream pathways:

    • Blocking specific G-protein coupling

    • Inhibiting distinct kinase cascades

    • Determining which effects persist when particular downstream pathways are blocked

Integration of Multiple Experimental Systems:

  • In vitro cellular systems provide mechanistic insights into direct signaling

  • Ex vivo tissue explants maintain microenvironmental context

  • In vivo models capture systemic effects and cell-cell interactions

  • Comparative analysis across these platforms helps separate direct from indirect mechanisms

By systematically applying these approaches, researchers can construct a hierarchical model of S1PR4 effects, distinguishing primary receptor-mediated events from secondary consequences in complex immune responses.

What statistical approaches are recommended for analyzing S1PR4 expression data in clinical samples?

Analyzing S1PR4 expression in clinical samples requires robust statistical approaches to address biological variability and extract meaningful correlations:

Expression Analysis Methods:

  • Data Normalization Strategies:

    • RNA-seq data: TPM/FPKM normalization with appropriate batch correction

    • Protein quantification: Normalization to housekeeping proteins

    • IHC/IF analysis: Standardized scoring systems (H-score, percentage positive cells)

  • Expression Threshold Determination:

    • ROC curve analysis to identify optimal cutoff points for dichotomizing S1PR4 expression

    • Consideration of natural breaks in expression distribution

    • Comparison with reference tissue expression

Survival Analysis Approaches:

Correlation Analysis Methods:

  • Gene-Gene Correlations:

    • Pearson/Spearman correlation coefficients to quantify relationships between S1PR4 and immune markers

    • Significant positive correlations have been established between S1PR4 and CD8+ T cell markers (CD8A, CD8B) and cytotoxicity markers (IFNG, GZMB)

  • Gene Set Enrichment Analysis:

    • GSEA to identify pathways associated with S1PR4 expression

    • Correlation with established immune signatures

    • Association with tertiary lymphoid structure (TLS) markers

Validation Approaches:

  • Cross-Validation Strategies:

    • Testing findings across multiple independent datasets

    • Validation in prospective cohorts

    • Comparison across different analytical platforms

  • Multiple Testing Correction:

    • Application of FDR or Bonferroni correction for genome-wide analyses

    • Careful interpretation of p-values in the context of multiple testing

These statistical approaches provide a framework for robust analysis of S1PR4 expression in clinical samples, enabling reliable biomarker development and mechanistic insights.

How should researchers interpret contradictory findings about S1PR4 function across different experimental models?

The literature reveals seemingly contradictory findings regarding S1PR4 function across different experimental models, requiring careful interpretation and reconciliation:

Observed Contradictions and Their Interpretation:

1. Pro- versus Anti-inflammatory Effects:

  • In airway sensitization models, S1PR4 deficiency leads to aggravated pulmonary inflammation with increased granulocyte recruitment and activation

  • In contrast, in psoriasis-like skin inflammation models, S1PR4 deficiency reduces inflammation by impairing chemokine/cytokine production by macrophages

Interpretation Framework:

  • Context-Dependent Analysis:

    • Tissue microenvironment differences (lung vs. skin)

    • Underlying pathophysiology of each model

    • Specific immune cell populations predominant in each context

  • Cell Type-Specific Assessment:

    • Determining which cell populations express functional S1PR4 in each model

    • Analyzing cell-specific knockout effects versus global deletion

    • Considering compensatory mechanisms in different cell lineages

  • Temporal Considerations:

    • Acute versus chronic inflammation models

    • Early innate versus late adaptive phases

    • Evaluation of feedback mechanisms that may reverse initial effects

Methodological Reconciliation Strategies:

  • Direct Comparison Studies:

    • Applying identical analytical methods across different models

    • Using matched genetic backgrounds and controlled environmental conditions

    • Performing side-by-side comparisons with standardized readouts

  • Mechanistic Dissection:

    • Identification of common signaling nodes versus divergent pathways

    • Elucidation of model-specific cofactors that may alter receptor function

    • Detailed analysis of S1P gradients and receptor expression dynamics in each model

  • Integration of Multiple Datasets:

    • Meta-analysis approaches to identify consistent versus variable effects

    • Systems biology modeling to predict context-dependent outcomes

    • Network analysis to map differential signaling in various conditions

The seemingly contradictory findings about S1PR4 function likely reflect its genuine biological complexity rather than experimental artifacts. By methodically analyzing these differences, researchers can develop a more nuanced understanding of how this receptor functions across diverse physiological and pathological contexts.

What are the critical quality control parameters for validating recombinant human S1PR4 preparations?

Ensuring the quality and functionality of recombinant human S1PR4 preparations is essential for reliable experimental outcomes. Critical quality control parameters include:

Structural and Biochemical Validation:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (>95% purity recommended)

    • Western blotting with specific anti-S1PR4 antibodies

    • Mass spectrometry to confirm protein identity and detect contaminants

  • Proper Folding Verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal stability assays to determine protein stability

    • Native PAGE to evaluate oligomeric state

  • Post-translational Modification Analysis:

    • Glycosylation profiling (S1PR4 contains potential N-glycosylation sites)

    • Phosphorylation state assessment

    • Mass spectrometry to confirm expected modifications

Functional Validation:

  • Ligand Binding Assays:

    • Saturation binding with labeled S1P or synthetic ligands

    • Competition binding assays to determine specificity

    • Scatchard analysis to calculate binding affinity (Kd)

  • Signaling Competence:

    • G protein activation assays (GTPγS binding)

    • Calcium mobilization assays in reconstituted cell systems

    • ERK phosphorylation as downstream readout of receptor activation

  • Cell-Based Functional Assays:

    • Migration assays using S1PR4-expressing immune cells

    • Cytokine production in response to receptor stimulation

    • Comparison with endogenous receptor activity in primary cells

Stability and Storage Validation:

  • Accelerated Stability Testing:

    • Activity retention after temperature cycling

    • Functional testing after multiple freeze-thaw cycles

    • Long-term storage stability at different temperatures

  • Formulation Optimization:

    • Buffer compatibility assessment

    • Stabilizing additive screening

    • Aggregation propensity monitoring during storage

  • Lot-to-Lot Consistency:

    • Functional comparison between different production batches

    • Standardized QC metrics for batch release

    • Reference standard comparison

These rigorous quality control parameters ensure that recombinant human S1PR4 preparations maintain native-like properties and biological activity, essential for generating reproducible and physiologically relevant experimental results.

How can researchers effectively design genetic manipulation studies to investigate S1PR4 function?

Designing effective genetic manipulation studies for S1PR4 requires careful consideration of multiple factors to ensure physiologically relevant outcomes:

Knockout Strategy Design:

  • Global versus Conditional Approaches:

    • Global S1PR4-/- models are valuable for initial phenotypic characterization

    • Cell type-specific conditional knockouts using Cre-lox systems help dissect:

      • Myeloid-specific functions (LysM-Cre)

      • T cell-specific roles (CD4-Cre)

      • Neutrophil-specific effects (MRP8-Cre)

  • Temporal Control Considerations:

    • Inducible knockout systems (tamoxifen-inducible CreERT2) allow temporal control

    • Separate developmental versus functional roles

    • Study acute versus chronic effects of receptor deletion

  • Genetic Background Selection:

    • Backcrossing to ensure consistent genetic background

    • Consider strain-specific differences in immune responses

    • Include appropriate wild-type littermate controls

Gene Editing Approaches:

  • CRISPR/Cas9 Applications:

    • Complete gene knockout via frameshift mutations

    • Targeted mutations of specific functional domains:

      • G protein coupling interface

      • Ligand binding pocket

      • Intracellular regulatory regions

    • Knock-in of reporter tags for visualization

  • Overexpression Systems:

    • Physiologically relevant promoters to maintain expression patterns

    • Inducible expression systems to control timing and magnitude

    • Combination with knockout backgrounds for rescue experiments

Validation Strategy:

  • Comprehensive Confirmation of Genetic Modification:

    • Genomic PCR to verify targeted modifications

    • RT-qPCR to confirm transcript absence/alteration

    • Western blotting and flow cytometry to verify protein elimination

    • Functional assays to confirm loss of receptor activity

  • Control for Compensatory Mechanisms:

    • Analysis of other S1P receptor expression changes

    • Assessment of alternative signaling pathway activation

    • Time-course studies to identify adaptive responses

  • Phenotypic Analysis Framework:

    • Multi-parametric assessment of immune cell development

    • Challenge models to reveal functional deficits:

      • TH1 footpad immunization

      • Cancer models

      • Inflammatory disease models

Complementary Approaches:

  • Rescue Experiments:

    • Re-expression of wild-type S1PR4 in knockout backgrounds

    • Structure-function analysis with mutant receptors

    • Cell type-specific rescue to confirm autonomous effects

  • Chimeric Mouse Generation:

    • Bone marrow transplantation between WT and S1PR4-/- mice

    • Mixed bone marrow chimeras to assess competitive fitness

    • Tissue-restricted chimeras to isolate compartment-specific effects

By implementing these design considerations, researchers can develop genetic manipulation studies that effectively isolate and characterize S1PR4 functions across different cellular contexts and physiological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.