Recombinant Human Squalene monooxygenase (SQLE)

Shipped with Ice Packs
In Stock

Description

Recombinant Human Squalene Monooxygenase (SQLE): Definition and Overview

Recombinant Human Squalene Monooxygenase (SQLE) is a genetically engineered form of the human enzyme squalene monooxygenase (also called squalene epoxidase), produced through recombinant DNA technology. It catalyzes the stereospecific epoxidation of squalene to 2,3-oxidosqualene, a critical step in cholesterol biosynthesis .

PropertyDetails
GeneSQLE (chromosome 8q24.1)
Expression SystemsE. coli, insect cells, mammalian systems (e.g., HEK293T)
Key DomainsN-terminal regulatory domain (SM-N100), catalytic domain (flavin-binding)
CofactorsNADPH, molecular oxygen, FAD (flavin adenine dinucleotide)

SQLE is a rate-limiting enzyme in the mevalonate pathway, with its activity tightly regulated by cholesterol levels and squalene accumulation . Recombinant SQLE is widely used in biochemical assays, structural studies, and drug development to study cholesterol metabolism and cancer biology .

Regulatory Mechanisms and Dysregulation in Disease

SQLE is regulated at multiple levels:

Regulatory LevelMechanism
TranscriptionalSREBP2 activates SQLE expression in low-cholesterol states
Post-TranslationalCholesterol promotes MARCH6-mediated ubiquitination and proteasomal degradation
FeedbackSqualene accumulation stabilizes SQLE by disrupting its interaction with MARCH6

Dysregulation in Cancer
SQLE overexpression is linked to poor prognosis in breast, lung, and liver cancers . In hypoxic tumor microenvironments, SQLE is truncated to a constitutively active form (trunSM), driving cholesterol synthesis and promoting cell survival . Recombinant SQLE models have shown that inhibition enhances radiosensitivity by inducing squalene accumulation and ER stress .

Research Applications and Therapeutic Targets

Recombinant SQLE is pivotal in preclinical studies:

ApplicationExamples
Drug ScreeningHigh-throughput assays for SQLE inhibitors (e.g., NB-598, terbinafine)
Structural BiologyCrystallography studies to design isoform-selective inhibitors
Cancer TherapyRadiosensitization via SQLE inhibition (enhances DNA damage response)

Key Inhibitors and Their Mechanisms

InhibitorTargetEffect
NB-598Catalytic domainStabilizes truncated SQLE (trunSM)
TerbinafineActive siteUsed in antifungal and anticancer studies
StatinsUpstream HMGCRIndirectly reduces SQLE substrate (squalene)

Clinical Relevance and Future Directions

SQLE’s role in cancer and metabolic disorders makes it a promising therapeutic target:

  1. Cancer Treatment: SQLE inhibition suppresses tumor growth and enhances radiation efficacy .

  2. Cholesterol Disorders: Truncation-resistant SQLE variants may treat hypercholesterolemia .

  3. Ferroptosis Modulation: SQLE activity impacts iron-dependent cell death pathways, offering new avenues for cancer therapy .

Recombinant SQLE remains central to advancing these applications, particularly in structure-based drug design and personalized medicine strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SQLE; ERG1; Squalene monooxygenase; Squalene epoxidase; SE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-574
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SQLE
Target Protein Sequence
MWTFLGIATFTYFYKKFGDFITLANREVLLCVLVFLSLGLVLSYRCRHRNGGLLGRQQSG SQFALFSDILSGLPFIGFFWAKSPPESENKEQLEARRRRKGTNISETSLIGTAACTSTSS QNDPEVIIVGAGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGL GDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAE PNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKV SVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYM VEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGG MTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSAT DDSLHQLRKACFLYFKLGGECVAGPVGLLSVLSPNPLVLIGHFFAVAIYAVYFCFKSEPW ITKPRALLSSGAVLYKACSVIFPLIYSEMKYMVH
Uniprot No.

Target Background

Function
Squalene monooxygenase (SQLE) catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, playing a crucial role as a rate-limiting enzyme in steroid biosynthesis.
Gene References Into Functions
  1. Our findings suggest a model where the amphipathic helix in SQLE N100 reversibly attaches to the ER membrane based on cholesterol levels. Excess cholesterol leads to the ejection and unraveling of the helix, exposing a hydrophobic patch that acts as a degradation signal. PMID: 28972164
  2. Both HMGCR and SQLE promoters possess two SREs, which may function as a homing region attracting a single SREBP-2 homodimer. PMID: 28342963
  3. Evidence indicates that microRNA miR-133b-dependent SQLE plays a critical role in potential metastasis mechanisms in esophageal squamous cell carcinoma (ESCC). PMID: 28069586
  4. Our research identifies SQLE as a bona fide metabolic oncogene through amplification, and as a potential therapeutic target in breast cancer (BC). These findings may have implications for other cancer types. PMID: 26777065
  5. This study has identified a Squalene Monooxygenase region closely associated with the endoplasmic reticulum membrane, likely involved in interactions with cholesterol or responses to cholesterol-induced membrane effects. PMID: 26434806
  6. SQLE overexpression in HCC cells promoted cell proliferation and migration, while downregulation of SQLE inhibited the tumorigenicity of Hepatocellular carcinoma cells in vitro and in vivo. PMID: 25787749
  7. Data suggest that unsaturated fatty acids (oleate; oleoyl-CoA) stabilize SM/SQLE (which catalyzes the first oxygenation step in cholesterol synthesis) potentially through inhibition of poly-ubiquitination by MARCH6 (membrane-associated ring finger [C3HC4] 6). PMID: 24840124
  8. MARCH6 and squalene monooxygenase (SM) physically interact, and consistent with MARCH6 acting as an E3 ligase, its overexpression reduces SM abundance in a RING-dependent manner. PMID: 24449766
  9. Functional promotor regions involved in transcription were determined. PMID: 12083769
  10. A cDNA library comprising 220 upregulated genes in tumor tissue was established and named as LSCC. Differential expression was confirmed in five of these genes, including IGFBP5, SQLE, RAP2B, CLDN1, and TBL1XR1. PMID: 17316888
  11. Distant metastasis-free survival in stage I/II breast cancer cases was significantly inversely related to SQLE mRNA in multivariate Cox analysis in two independent patient cohorts of 160 patients each. PMID: 18728668
Database Links

HGNC: 11279

OMIM: 602019

KEGG: hsa:6713

STRING: 9606.ENSP00000265896

UniGene: Hs.71465

Protein Families
Squalene monooxygenase family
Subcellular Location
Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein.
Tissue Specificity
Detected in liver (at protein level).

Q&A

What is Squalene Monooxygenase (SQLE) and what is its role in cholesterol biosynthesis?

Squalene Monooxygenase (SQLE), also referred to as SM in some research contexts, is the first oxygen-dependent enzyme in the committed cholesterol synthesis pathway. It catalyzes the conversion of squalene to 2,3-oxidosqualene, requiring molecular oxygen as a cofactor. This is a critical step in cholesterol biosynthesis, which is highly oxygen-intensive, with each cholesterol molecule requiring 11 oxygen molecules for its synthesis . SQLE's activity represents a rate-limiting step in the pathway, making it an important control point for cholesterol production.

The reaction catalyzed by SQLE is particularly significant because:

  • It represents the entry into the committed sterol synthesis pathway

  • It is among the most energy and oxygen-demanding steps in sterol synthesis

  • It serves as a regulatory node in cellular responses to oxygen and sterol levels

  • It processes squalene, which can be toxic in excess to cells

How can researchers effectively design experiments to study SQLE regulation?

When designing experiments to study SQLE regulation, researchers should consider:

Cell culture conditions:

  • For hypoxia experiments: Use established hypoxic chambers with precise oxygen concentration control (typically 1-2% O₂)

  • Include appropriate time course measurements (2, 4, 8, and 24 hours) to capture both acute and sustained responses

  • Monitor cell viability during experiments as hypoxia can induce stress responses that may confound results

Analytical techniques:

  • Western blotting with antibodies specific to both full-length and truncated forms of SQLE

  • Gas chromatography-mass spectrometry for detection and quantification of squalene and downstream sterol intermediates

  • qRT-PCR to assess transcriptional regulation versus post-translational modifications

Controls to include:

  • Normoxic controls (21% O₂) matched for time points

  • Pharmacological controls using SQLE inhibitors (e.g., NB-598) to distinguish direct enzyme effects

  • SQLE knockout or knockdown controls to confirm specificity of observations

When analyzing data, researchers should compare multiple analytical techniques and recognize that very small changes in squalene levels can trigger significant biological responses, necessitating highly sensitive detection methods .

What model systems are most appropriate for studying SQLE function?

The choice of model system should align with specific research questions:

Cell line models:

  • HEK293T cells: Used extensively for molecular mechanism studies due to high transfection efficiency

  • Huh7 cells: Liver-derived cells appropriate for cholesterol metabolism studies

  • Cancer cell lines: Particularly useful when investigating links between SQLE and oncogenesis

Genetic manipulation approaches:

  • CRISPR/Cas9 SQLE knockout models to study pathway dependencies

  • Site-directed mutagenesis of key residues (e.g., Y195F catalytic mutant) to investigate structure-function relationships

  • Inducible expression systems to control SQLE levels temporally

Readout considerations:

  • For basic enzyme activity: Direct measurement of squalene conversion to 2,3-oxidosqualene

  • For pathway activity: Downstream sterol intermediate profiles

  • For phenotypic outcomes: Cell proliferation, membrane composition, or cancer-relevant phenotypes

Each model system has advantages and limitations that should be acknowledged in experimental design and data interpretation.

How does hypoxia affect SQLE regulation and what methodologies best capture these changes?

Hypoxia induces a two-part regulatory mechanism affecting SQLE:

  • Increased targeting to the proteasome:

    • Hypoxia stabilizes the E3 ubiquitin ligase MARCHF6, which increases ubiquitination of SQLE

    • This promotes partial degradation of SQLE by the proteasome

  • Generation of constitutively active truncated form:

    • Substrate (squalene) accumulation during hypoxia impedes complete degradation

    • This results in a truncated form of SQLE (trunSM) that remains enzymatically active

    • The truncated form lacks the N-terminal regulatory domain but retains catalytic activity

Recommended methodologies:

For detecting truncated SQLE:

  • Western blotting with antibodies targeting different epitopes to distinguish between full-length and truncated forms

  • Protein mass spectrometry to characterize the exact cleavage site and post-translational modifications

For functional analysis:

  • Enzyme activity assays under varying oxygen concentrations (21%, 5%, 1%, 0.1% O₂)

  • Live-cell imaging with fluorescently tagged SQLE to track subcellular localization during hypoxia

  • Proteasome inhibition studies (MG132) coupled with MARCHF6 manipulation to dissect the degradation mechanism

For metabolite analysis:

  • Targeted metabolomics focusing on cholesterol precursors with temporal resolution

  • Isotope labeling of squalene to track metabolic flux under hypoxic conditions

This combined methodological approach can comprehensively characterize the complex response of SQLE to hypoxia.

What are the methodological considerations when investigating SQLE as a cancer biomarker?

When investigating SQLE as a cancer biomarker, researchers should implement the following methodological approaches:

Patient cohort selection:

  • Include diverse cancer types with sufficient sample sizes for statistical power

  • Collect matched tumor and adjacent normal tissue when possible

  • Include well-annotated clinical information including stage, grade, treatment history, and outcomes

Expression analysis techniques:

  • RNAseq for transcriptomic profiling with TPM normalization

  • Immunohistochemistry with validated antibodies for protein expression

  • Consider single-cell sequencing to identify cell-specific expression patterns

Survival analysis methodology:

  • Kaplan-Meier survival curves with appropriate statistical testing (log-rank)

  • Calculate hazard ratios with 95% confidence intervals using Cox proportional hazards models

  • Stratify patients based on SQLE expression levels (high vs. low using median or quartile cutoffs)

Multivariate analysis:

  • Include relevant clinical covariates (age, sex, stage, grade)

  • Adjust for known prognostic factors specific to the cancer type

  • Consider competing risk models when appropriate

The table below summarizes key statistical approaches used in SQLE biomarker studies:

Analysis TypeStatistical MethodSoftware/PackageKey Outputs
Differential ExpressionStudent's t-test or ANOVAR or similarp-value, fold change
Survival AnalysisKaplan-Meier with log-rank testR survival package HR, 95% CI, p-value
Correlation AnalysisSpearman's or Pearson'sR or similarr value, p-value
Multivariate AnalysisCox proportional hazardsR survival packageAdjusted HR, p-value

When reporting results, researchers should clearly describe all methodological details to ensure reproducibility, including the database sources used (e.g., TCGA) .

How can researchers effectively analyze the relationship between SQLE and immune infiltration in tumors?

Investigating the relationship between SQLE and immune infiltration requires specialized bioinformatic and experimental approaches:

Computational methods:

  • Single-sample Gene Set Enrichment Analysis (ssGSEA) to quantify immune cell infiltration from bulk RNA sequencing data

  • Use the GSVA R package (http://www.biocondutor.org/package/release/bioc/html/GSVA.html) to calculate enrichment scores for immune cell gene signatures

  • Implement Spearman's correlation analysis to identify relationships between SQLE expression and each immune cell subset

Database resources:

  • TISIDB database (http://cis.hku.hk/TISIDB/) for analyzing correlations between SQLE expression and immune checkpoint genes using the "Immunomodulator" module

  • LinkedOmics database (http://www.linkedomics.org) for exploring co-expression networks and pathway enrichment

  • TCGA database for primary tumor expression data and matched clinical information

Experimental validation:

  • Flow cytometry or mass cytometry (CyTOF) to validate computational predictions

  • Multiplex immunohistochemistry to spatially resolve immune cell populations in relation to SQLE-expressing cells

  • In vitro co-culture systems to directly test interactions between SQLE-overexpressing cancer cells and immune cells

When reporting correlations between SQLE and immune infiltration, researchers should present:

  • Correlation coefficients with statistical significance

  • Scatter plots of SQLE expression versus immune cell signatures

  • Heatmaps showing relationships across multiple immune cell types

  • Functional enrichment of co-expressed genes to provide biological context

These approaches collectively provide a comprehensive assessment of SQLE's role in tumor immunology.

What methodological approaches should be used to study SQLE truncation and its functional consequences?

Studying SQLE truncation and its functional consequences requires advanced molecular biology techniques and careful experimental design:

Molecular tools for studying truncation:

  • Generate expression constructs for full-length SQLE and truncated forms (e.g., SM[ΔN65]-V5)

  • Create catalytically inactive mutants (Y195F) to distinguish between direct binding versus catalytic effects

  • Establish SQLE-knockout cell lines using CRISPR/Cas9 to provide a clean background for truncation studies

Truncation mechanism investigation:

  • Use proteasome inhibitors (MG132) to confirm involvement of the ubiquitin-proteasome system

  • Implement cycloheximide chase assays to determine protein stability differences between full-length and truncated forms

  • Perform site-directed mutagenesis of key residues in the N-terminal domain to identify regions critical for regulated degradation

Functional analysis methodology:

  • Enzymatic activity assays comparing full-length versus truncated SQLE

  • Metabolic flux analysis using labeled substrates to track pathway activity

  • Structural biology approaches (X-ray crystallography, cryo-EM) to understand conformational changes

Experimental challenges and solutions:

  • Low endogenous expression: Use sensitive detection methods like targeted mass spectrometry

  • Heterogeneity of truncation: Implement size-exclusion methods to isolate specific truncated forms

  • Lipid environment effects: Consider reconstitution in membrane-mimetic systems

When reporting truncation studies, researchers should clearly document the exact amino acid boundaries of truncated products and confirm findings using multiple detection methods.

How can researchers address contradictions in experimental data when studying SQLE function?

When researchers encounter contradictory data in SQLE studies, several methodological approaches can help resolve inconsistencies:

Sources of potential contradictions:

  • Differences in oxygen tension between experimental setups

  • Variations in cell types, culture conditions, or passage number

  • Substrate availability affecting enzyme activity

  • Different antibody specificities detecting distinct forms of SQLE

Methodological approaches to resolve contradictions:

  • Systematic parameter variation:

    • Test multiple oxygen concentrations (21%, 5%, 1%, 0.1% O₂) to identify threshold effects

    • Vary squalene concentrations to determine dose-dependent responses

    • Compare results across multiple cell lines to distinguish cell type-specific versus general mechanisms

  • Complementary detection methods:

    • Use multiple antibodies targeting different epitopes of SQLE

    • Combine Western blotting with mass spectrometry for protein verification

    • Implement both activity assays and product formation measurements

  • Statistical approaches:

    • Design experiments with adequate statistical power to detect effect sizes of interest

    • Use appropriate statistical tests based on data distribution

    • Implement mixed-effects models to account for batch effects and repeated measures

  • Contradiction detection in datasets:

    • Systematically compare datasets for logical contradictions (e.g., col1 > 5 and col1 < 0)

    • Apply computational approaches to identify and resolve contradictory findings

    • Document all experimental conditions thoroughly to enable proper comparison between studies

When resolving contradictions, researchers should consider that hypoxia and squalene may trigger biphasic responses, where different regulatory mechanisms dominate at different thresholds . This may explain apparently contradictory observations at different oxygen or substrate concentrations.

What are the key considerations for designing controlled experiments to study SQLE regulation?

Designing rigorous experiments to study SQLE regulation requires careful attention to several factors:

Independent and dependent variables:

  • Clearly define independent variables (e.g., oxygen concentration, squalene levels, drug treatments)

  • Select appropriate dependent variables (e.g., SQLE protein levels, truncation ratio, enzyme activity)

  • Control extraneous variables that might influence results (cell density, serum batch, passage number)

Control conditions:

  • Include appropriate negative controls (vehicle-only, normoxic conditions, non-targeting siRNAs)

  • Implement positive controls with known SQLE modulators (NB-598 inhibitor, cholesterol treatment)

  • Design genetic controls (SQLE knockouts, catalytically inactive mutants)

Experimental manipulations:

  • For protein studies: Use both overexpression and endogenous protein detection

  • For gene modulation: Compare siRNA, shRNA, and CRISPR approaches

  • For pharmacological studies: Use concentration gradients rather than single doses

Replication strategy:

  • Technical replicates: Minimum triplicate measurements for each condition

  • Biological replicates: Independent experiments with fresh cell preparations

  • Cross-validation: Test key findings in alternative cell lines or model systems

Statistical design considerations:

  • Perform power analysis to determine adequate sample sizes

  • Pre-specify primary and secondary endpoints

  • Plan appropriate statistical tests based on data distribution and experimental design

When reporting methods, researchers should provide sufficient detail to enable others to replicate the experimental conditions, including exact cell culture conditions, reagent sources, and analytical procedures.

What advanced analytical techniques should researchers consider when studying SQLE in cancer contexts?

Researchers investigating SQLE in cancer contexts should consider these advanced analytical techniques:

Multi-omics integration approaches:

  • Combine transcriptomic, proteomic, and metabolomic data for comprehensive pathway analysis

  • Integrate chromatin accessibility (ATAC-seq) with expression data to identify regulatory mechanisms

  • Correlate SQLE expression with mutation data to identify genetic interactions

Patient-derived models:

  • Patient-derived xenografts (PDX) to maintain tumor heterogeneity

  • Patient-derived organoids for 3D culture systems

  • Ex vivo tumor slice cultures for maintaining tumor microenvironment

Spatial analysis techniques:

  • Multiplex immunofluorescence to co-localize SQLE with markers of hypoxia and proliferation

  • Spatial transcriptomics to map SQLE expression within the tumor microenvironment

  • Mass spectrometry imaging for spatial mapping of lipids and cholesterol intermediates

Cancer-specific analytical considerations:

  • Single-cell RNA sequencing to resolve heterogeneity in SQLE expression

  • Clonal evolution tracking to determine if SQLE alterations are early or late events

  • Circulating tumor cell analysis for potential biomarker applications

Computational approaches:

  • Machine learning to identify SQLE expression patterns associated with clinical outcomes

  • Network analysis to place SQLE in the context of broader cancer pathways

  • Pharmacogenomic modeling to predict sensitivity to SQLE-targeting approaches

By combining these advanced techniques, researchers can develop a more comprehensive understanding of SQLE's role in cancer biology and potentially identify new therapeutic strategies.

What are the future directions for SQLE research methodologies?

The field of SQLE research is evolving rapidly, with several promising methodological directions:

Emerging technologies:

  • CRISPR base editing for precise modification of SQLE regulatory regions

  • Protein degradation technologies (PROTACs) for targeted SQLE modulation

  • Live-cell metabolic imaging to track cholesterol synthesis in real-time

Integrative approaches:

  • Systems biology models incorporating SQLE within cholesterol homeostasis networks

  • Multi-scale modeling from molecular interactions to cellular phenotypes

  • Translational pipelines connecting basic SQLE mechanisms to clinical applications

Methodological innovations:

  • Development of more specific SQLE inhibitors with reduced toxicity profiles

  • Advanced protein engineering approaches to study SQLE structure-function relationships

  • Improved detection methods for squalene and related metabolites at physiological concentrations

Translational considerations:

  • Standardized protocols for assessing SQLE as a biomarker across cancer types

  • Development of SQLE-based patient stratification approaches

  • Methods to target truncated SQLE specifically in disease contexts

By pursuing these methodological advances, researchers will be better positioned to understand the complex regulation of SQLE and its roles in both normal physiology and disease states, particularly in cancer and metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.