Recombinant Human StAR-related lipid transfer protein 3 (STARD3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
STARD3; CAB1; MLN64; StAR-related lipid transfer protein 3; Metastatic lymph node gene 64 protein; MLN 64; Protein CAB1; START domain-containing protein 3; StARD3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFD LLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRH WWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEE ERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIR QGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEV ILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRY LSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIH QSLAATMFEFAFHLRQRISELGARA
Uniprot No.

Target Background

Function
STARD3, a sterol-binding protein, plays a crucial role in cholesterol transport from the endoplasmic reticulum to endosomes. It establishes a contact point between the endoplasmic reticulum and late endosomes, localizing to late endosome membranes and interacting with VAPA and VAPB to connect with the endoplasmic reticulum. As a lipid transfer protein, STARD3 redirects sterol to the endosome, impacting the cell membrane and favoring membrane formation within endosomes. While it might mediate cholesterol transport between other membranes, such as mitochondrial or cell membranes, additional experimental evidence is needed. Primarily, STARD3 facilitates cholesterol transport from the endoplasmic reticulum to endosomes. It does not activate transcriptional cholesterol sensing. STARD3 can bind other lipids, including lutein, a xanthophyll carotenoid responsible for the macular pigment in the retina.
Gene References Into Functions
  1. Research suggests that MLN64 overexpression leads to increased mitochondrial cholesterol content and consequently decreased mitochondrial GSH content, resulting in mitochondrial dysfunction. Notably, MLN64 expression is elevated in Niemann-Pick C1 deficient cells and plays a significant role in cholesterol transport into mitochondria. PMID: 28282615
  2. A case study presents a rare instance of a 46,XY patient with congenital heart disease (CHD) associated with ambiguous genitalia, characterized by a clitoris-like phallus and a bifid scrotum. Exome sequencing revealed novel homozygous mutations in the FGFR1 and STARD3 genes, potentially contributing to the observed phenotype. PMID: 27055092
  3. The structure of the lutein-binding domain of human StARD3 at 1.74 A resolution and a model of a complex with lutein have been presented. PMID: 27487925
  4. STARD3 acts as a cholesterol transporter, scaffolding endoplasmic reticulum-endosome contacts and modulating cellular cholesterol distribution by delivering cholesterol to endosomes. PMID: 28377464
  5. STARD3 or STARD3NL-mediated ER-endosome contacts, influencing endosome dynamics, are believed to be involved in cholesterol transport. PMID: 27068960
  6. Elevated StARD3 expression may contribute to breast cancer aggressiveness by increasing membrane cholesterol and enhancing oncogenic signaling. PMID: 25681734
  7. Data indicate that mitochondrial proteolytic activation of START domain-containing protein 3 (STARD3) enhances steroidogenesis. PMID: 25459514
  8. Findings show that PPP1R1B-STARD3 fusion transcript plays a key role in subsets of gastric cancers through the activation of PI3K/AKT signaling. PMID: 24276243
  9. STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the endoplasmic reticulum. PMID: 24105263
  10. Haplotype analysis indicated that the combined effect of STARD3 variants (rs9972882, rs881844, rs11869286, and rs1877031) might affect the risk of gastric cancer. PMID: 24291029
  11. With saturating MLN64, steroidogenesis by placental mitochondria proceeds at a near-maximal rate. PMID: 14715710
  12. Data indicate that StARD3 is the primary lutein-binding protein in the macula lutea; recombinant StARD3 selectively binds lutein with high affinity. PMID: 21322544
  13. A transport pathway for endosomal cholesterol to mitochondria that requires MLN64, but not NPC1, has been identified. PMID: 19965586
  14. FAK contributed to the increased adhesion in MDA-MB-231DeltaMLN64 cells. PMID: 20198306
  15. The role of MLN64 in cholesterol transport from lysosomes to steroidogenic mitochondria has been investigated. PMID: 12070139
  16. The MENTAL (MLN64 amino-terminal shared with MENTHO) domain might serve to maintain cholesterol at the membrane of late endosomes prior to its shuttle to cytoplasmic acceptor(s). PMID: 15718238
  17. Local sterol enrichment by MLN64 in the late endosomal membranes facilitates their association with actin, thereby governing actin-dependent fusion and degradative activity of late endocytic organelles. PMID: 15930133
  18. In this review, MLN64 defines discrete cholesterol-containing subdomains within the membrane of late endosomes where they may function in cholesterol transport. PMID: 16709157
  19. Three-dimensional atomic models of the StART domains of metastatic lymph node 64 (MLN64) and steroidogenic acute regulatory protein (StAR) proteins in complex with cholesterol have been developed. PMID: 16990645
  20. Evidence for differential cholesterol binding of the two most closely related START domain proteins STARD1 and STARD3 has been provided. PMID: 18331352
  21. Differential regulation of STARD1 and D3 reflects their distinct roles in macrophage cholesterol metabolism, and may inform anti-atherogenic strategies. PMID: 19272380
  22. Oncogenomic recombination hotspot around the PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at human chromosome 17q12 is closely linked to evolutionary recombination hotspot around the GSDML-GSDM locus. PMID: 15010812

Show More

Hide All

Database Links

HGNC: 17579

OMIM: 607048

KEGG: hsa:10948

STRING: 9606.ENSP00000337446

UniGene: Hs.728838

Protein Families
STARD3 family
Subcellular Location
Late endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in retina.

Q&A

What is the domain architecture of STARD3 and how does it relate to function?

STARD3 contains three key structural components that work together to enable its lipid transfer function:

  • A MENTAL (MLN64 N-terminal) domain at the N-terminus that serves as a transmembrane anchor in the endosomal membrane

  • A FFAT (two phenylalanines in an acidic tract) motif located carboxy terminal to the MENTAL domain

  • A START (StAR-related lipid transfer) domain at the C-terminus that binds and transfers sterols

The MENTAL domain anchors STARD3 in late endosomes, while the FFAT motif interacts with ER-localized VAP-A and VAP-B proteins to create zones of close apposition between the ER network and endosomes. The START domain is responsible for the actual binding and transfer of sterols between membranes .

How does STARD3 differ from other sterol transport proteins like CERT/STARD11?

While both STARD3 and CERT (STARD11) belong to the START domain protein family and create membrane contact sites, they differ in several important aspects:

  • Cargo specificity: STARD3 transports sterols, while CERT specifically transports ceramide

  • Localization: STARD3 creates ER-endosome contacts, while CERT functions at ER-Golgi contacts

  • Domain structure: Both contain START domains and FFAT motifs, but CERT has a PH domain that targets the Golgi, whereas STARD3 has a MENTAL domain targeting endosomes

  • Transport direction: STARD3 transports sterols from the ER to endosomes, while CERT transports ceramide from the ER to the Golgi for sphingomyelin synthesis

What experimental evidence demonstrates STARD3's role in cholesterol accumulation in endosomes?

Multiple experimental approaches provide evidence for STARD3's role in cholesterol accumulation:

  • Using fluorescent probes: GFP-D4 (the D4 fragment of perfringolysin O fused to GFP) and filipin (polyene macrolide from Streptomyces filipinensis) demonstrate increased cholesterol in endosomes of STARD3-expressing cells

  • Quantification shows STARD3-expressing cells display ~4 times higher intracellular filipin staining compared to control cells

  • Co-localization studies show that STARD3-positive endosomes are strongly labeled with cholesterol probes

  • Most GFP-D4-positive vesicles are also positive for STARD3 and Lamp1 (late endosome marker), with correlated signal intensity

  • Semi-automated image segmentation analysis confirms increased intracellular sterol levels in STARD3-expressing cells

What are the optimal techniques for visualizing and quantifying intracellular cholesterol distribution in STARD3 research?

Researchers studying STARD3 should consider these complementary approaches for cholesterol visualization:

  • GFP-D4 probe:

    • Advantages: High specificity, binds only to membranes containing >35 mol% sterol

    • Limitations: May miss endosomes with lower sterol content

    • Best for: Identifying endosomes with massive cholesterol accumulation

  • Filipin staining:

    • Advantages: Labels more endosomal vesicles than GFP-D4, detecting a broader range of cholesterol levels

    • Limitations: Less specific than GFP-D4, requires careful fixation protocols

    • Best for: Quantifying total intracellular cholesterol levels

  • Semi-automated image analysis:

    • Protocol: Image segmentation and quantitative analysis of intracellular filipin staining

    • Advantage: Allows systematic measurement of intracellular sterol levels across many cells

    • Application: Particularly useful for comparing cholesterol distribution between control and STARD3-expressing cells

How can researchers reconstitute STARD3-mediated sterol transfer in vitro?

The in vitro reconstitution of STARD3-mediated sterol transfer requires:

  • Protein components:

    • Recombinant cSTD3 (cytosolic STARD3 without the MENTAL domain but with FFAT motif and START domain)

    • Purified VAP-His6 and VAP(KD/MD)-His6 mutant as control

  • Membrane model systems:

    • LA liposomes: Containing MPB-PE lipids for cSTD3 attachment

    • LB liposomes: Including DHE (10 mol%) and DNS-PE (2.5 mol%) with VAP-His6

  • Experimental setup for measuring transport:

    • Attach cSTD3 to LA liposomes via a cysteine residue at its N-terminal end

    • Add LB liposomes with VAP-His6

    • Measure DHE transfer in real time by FRET

  • Controls to validate specificity:

    • LA liposomes without MPB-PE

    • LB liposomes without VAP

    • LB liposomes with VAP(KD/MD) mutant that cannot bind FFAT motifs

What mutant constructs are most informative for dissecting STARD3 function?

Key STARD3 mutants for functional analysis include:

  • FFAT motif mutants:

    • STARD3 F207A/Y208A (FA/YA mutant): Disrupts VAP binding and ER-endosome contact formation

    • 7G mutant: FFAT motif substituted with glycine stretch, prevents interaction with VAP

    • Function: Test the requirement for membrane contact site formation

  • START domain mutants:

    • STARD3 M307R/N311D (MR/ND mutant): Blocks sterol transport capacity

    • STARD3 ΔSTART: Complete removal of the START domain

    • Function: Test the requirement for sterol binding and transfer

  • Experimental applications:

    • In vitro liposome aggregation assays: Test tethering capacity (using DLS)

    • DHE transport assays: Measure sterol transfer rates

    • In vivo cholesterol distribution: Visualize impact on cellular cholesterol localization

How does STARD3 affect plasma membrane cholesterol levels and what techniques best measure this effect?

STARD3 expression leads to reduced plasma membrane cholesterol through redirection to endosomes. This can be measured through:

  • Amphotericin B sensitivity assay:

    • Principle: Amphotericin B creates non-selective ion pores by binding PM cholesterol, causing cell death

    • Finding: STARD3-expressing cells show reduced sensitivity to amphotericin B

    • Control validation: Cells expressing STARD3 mutants (ΔSTART, MR/ND, or FA/YA) show normal sensitivity

    • Interpretation: Lower sensitivity indicates reduced PM cholesterol levels

  • Flow cytometry with GFP-D4:

    • Advantage: Quantifies membrane cholesterol labeling on a cell-by-cell basis for large populations

    • Result: HeLa/STARD3 cells show reduced GFP-D4 staining at the PM compared to control cells

    • Control validation: PM staining in cells expressing STARD3 mutants remains similar to control cells

    • Data analysis: Can process thousands of cells for statistical significance

What is the relationship between STARD3-mediated sterol transport and sterol sensing pathways?

Despite causing cholesterol redistribution, STARD3 expression does not disrupt cellular sterol sensing:

  • SREBP-2 cleavage analysis:

    • Under normal sterol conditions: No difference in SREBP-2 processing between STARD3-expressing and control cells

    • Under sterol depletion (LPDS medium or MβCD treatment): Similar increase in SREBP-2 cleavage in both cell types

    • With cholesterol addition: Both cell types maintain basal SREBP-2 cleavage levels

  • Target gene expression:

    • SREBP-2 regulated genes (HMGCoA reductase, LDLR, SREBF-2) respond normally to LDL addition

    • Both control and STARD3-expressing cells show similar expression pattern changes

  • Mechanistic interpretation:

    • Endosomal cholesterol accumulation does not activate the ER-based SREBP-2 cholesterol sensor

    • Suggests compartmentalization of cholesterol pools between endosomes and ER

    • STARD3-mediated transport does not deplete ER cholesterol below the threshold for SREBP activation

How do the kinetics of STARD3-mediated sterol transfer differ between in vitro and cellular contexts?

The kinetics of STARD3-mediated sterol transfer show important differences between reconstituted systems and cellular environments:

  • In vitro measurements (using purified components):

    • Initial DHE transport rate: 24.6 ± 3.8 DHE molecules/min per cSTD3

    • Equilibration time: Complete within minutes

    • Contact-dependent enhancement: 20-fold faster than non-tethered control conditions

  • Cellular context considerations:

    • Additional regulatory factors may modulate transport rates

    • Competing transport pathways influence net distribution

    • Membrane composition differences affect sterol accessibility

    • Counteracting homeostatic mechanisms may try to normalize distribution

  • Rate-limiting factors:

    • Membrane contact site formation appears critical for efficient transport

    • Sterol binding and release kinetics of the START domain

    • Local membrane composition may affect sterol extraction efficiency

What are common challenges in detecting endosomal cholesterol accumulation and how can they be addressed?

Researchers often encounter these challenges when trying to visualize endosomal cholesterol:

  • Probe specificity and sensitivity:

    • Challenge: GFP-D4 only binds membranes with >35 mol% cholesterol, potentially missing moderate accumulation

    • Solution: Use complementary probes with different thresholds (filipin detects lower cholesterol levels)

    • Recommendation: Perform co-labeling experiments with both probes to capture the heterogeneity of cholesterol levels

  • Fixation artifacts:

    • Challenge: Cholesterol redistribution during fixation can mask true localization

    • Solution: Optimize fixation protocols specifically for cholesterol preservation

    • Validation: Compare results across multiple fixation methods

  • Quantification variability:

    • Challenge: Cell-to-cell heterogeneity in endosomal cholesterol accumulation

    • Solution: Develop semi-automated image segmentation for systematic analysis

    • Implementation: Analyze many cells (n>100) per condition for statistical robustness

How can researchers distinguish between direct STARD3 effects and secondary cellular responses?

To differentiate direct STARD3 effects from secondary cellular adaptations:

  • Acute vs. chronic expression systems:

    • Use inducible expression systems to observe immediate effects before adaptive responses occur

    • Compare short-term (24h) vs. long-term (stable cell line) expression patterns

  • Mutant panel approach:

    • Utilize separate mutants targeting different STARD3 functions:

      • Membrane binding mutants (FFAT motif mutants)

      • Sterol transfer mutants (START domain mutants)

    • Expected pattern: If an effect requires both functions, it's likely a direct STARD3 effect

  • Pathway inhibitor validation:

    • Test whether effects persist when potential compensatory pathways are blocked

    • Example: Combine STARD3 expression with inhibitors of other cholesterol trafficking routes

What controls are essential for validating STARD3's role in sterol transfer at membrane contact sites?

Essential controls for rigorous validation include:

  • For tethering function:

    • VAP knockdown/knockout to prevent ER-endosome contact formation

    • FFAT motif mutants (FA/YA or 7G) that cannot bind VAP proteins

    • Microscopy confirmation of reduced contact sites using appropriate markers

  • For sterol transfer function:

    • START domain mutants (MR/ND) or deletions (ΔSTART) that maintain tethering but lack transfer ability

    • Sterol transport assays comparing wild-type vs. mutant proteins

    • Cholesterol visualization showing endosomal accumulation is dependent on functional START domain

  • Combined experimental approach:

    • Liposome aggregation assays (using DLS) to confirm tethering capacity

    • DHE transport measurements to quantify sterol transfer efficiency

    • Cellular phenotype assessment (cholesterol distribution, amphotericin B sensitivity)

How might STARD3 interact with other cholesterol trafficking pathways in cells?

Potential interactions between STARD3 and other cholesterol trafficking pathways warrant investigation:

  • STARD3 and the endosomal cholesterol export machinery:

    • Relationship with NPC1/NPC2 proteins that mobilize cholesterol from late endosomes

    • Interaction with ORP1L and RILP that regulate endosome positioning and cholesterol sensing

    • Potential competition or cooperation with the ESCRT machinery in endosomal membrane dynamics

  • STARD3 and other sterol transfer proteins:

    • Functional overlap or complementarity with ORP/OSBP family proteins

    • Relationship with other START domain proteins in cholesterol homeostasis

    • Potential redundancy mechanisms that might compensate for STARD3 deficiency

  • Integration with cellular cholesterol homeostasis:

    • Impact on LDL receptor recycling and endocytosis

    • Effects on sphingolipid metabolism and membrane organization

    • Relationship with sterol esterification pathways

What techniques could advance understanding of STARD3's role in membrane biogenesis inside endosomes?

Emerging techniques to explore STARD3's role in endosomal membrane formation:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize membrane contact sites at nanoscale resolution

    • Correlative light and electron microscopy to examine endosome ultrastructure

    • Live-cell imaging with fluorescent sterols to track transport dynamics in real-time

  • Biophysical and biochemical tools:

    • Reconstitution of endosomal membrane formation in giant unilamellar vesicles (GUVs)

    • Manipulation of membrane tension and curvature to study biophysical requirements

    • Lipid mass spectrometry to analyze compositional changes in isolated endosomes

  • Genetic approaches:

    • CRISPR-Cas9 genome editing to create cellular models with altered STARD3 levels or function

    • Synthetic biology approaches to engineer novel STARD3 variants with modified properties

    • Systems biology analysis of the endosomal membrane proteome in response to STARD3 modulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.