Recombinant Human STEAP family member 1B (STEAP1B)

Shipped with Ice Packs
In Stock

Description

Introduction to STEAP1B

STEAP1B is a member of the STEAP (Six-Transmembrane Epithelial Antigen of the Prostate) family of proteins, which includes STEAP1, STEAP2, STEAP3, and STEAP4. STEAP1B shares high sequence homology with STEAP1, particularly in the extracellular domain 2 (ECD2), but exhibits structural and functional divergence . STEAP1B is expressed in prostate cancer cells and has been implicated in tumor progression, though its precise role remains under investigation .

Expression in Prostate Cancer

STEAP1B, particularly STEAP1B2, is overexpressed in prostate cancer cells compared to non-neoplastic counterparts.

Regulatory Mechanisms

Cell LineSTEAP1B2 ExpressionRegulatory Factors
LNCaPHighSerum reduces STEAP1 stability
PNT1ALowSerum increases STEAP1 stability

Post-Transcriptional/Post-Translational Modifications:

  • mRNA Stability: STEAP1 mRNA is more stable in cancer cells (e.g., LNCaP) than normal cells (e.g., PNT1A) .

  • Serum Effects: Serum exposure inversely modulates STEAP1 stability in cancer vs. non-cancer cells, implicating context-dependent regulation .

Functional Roles in Cancer

STEAP1B’s role in prostate cancer is less characterized than STEAP1, but evidence suggests overlapping pathways:

STEAP1 vs. STEAP1B: Comparative Features

FeatureSTEAP1STEAP1B
Metalloreductase ActivityLimited (lacks FNO domain)Unconfirmed
Tumor MicroenvironmentPromotes intercellular communicationPotential role in stromal cell recruitment
CAR T Cell TargetingECD2-reactive CAR T cells effectiveNo activation observed in preclinical studies

STEAP1B’s Potential Mechanisms:

  • Cell Cycle Regulation: STEAP1 knockdown impairs proliferation and induces apoptosis . STEAP1B may share similar effects.

  • Antigen Presentation: STEAP1 loss in tumors correlates with downregulated MHC class I/II genes , but STEAP1B’s impact remains unclear.

Targeting STEAP1B

  • CAR T Cell Therapy: STEAP1-specific CAR T cells (e.g., STEAP1-BBζ) show efficacy against STEAP1-expressing tumors but fail to activate against STEAP1B-expressing cells, highlighting isoform-specific targeting limitations .

  • Bispecific Antibodies: Anti-STEAP1 antibodies (e.g., BC261) show cross-reactivity with STEAP1B in preclinical models, but clinical validation is pending .

Research Gaps and Future Directions

  1. Membrane Topology: Resolving ECD2’s localization in STEAP1B via crystallography.

  2. Functional Redundancy: Determining whether STEAP1B compensates for STEAP1 loss during immunotherapy.

  3. Epigenetic Regulation: Investigating promoter methylation or histone modifications that modulate STEAP1B expression .

Product Specs

Buffer
The default storage buffer for liquid delivery form is a Tris/PBS-based buffer containing 5%-50% glycerol. For lyophilized powder delivery form, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-245aa
Mol. Weight
30.3 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
STEAP1B
Target Protein Sequence
MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Gene References Into Functions
  1. STEAP1B transcripts share structural similarities with STEAP1 but may encode proteins with fewer transmembrane domains. The STEAP1B2 transcript is also overexpressed in neoplastic prostate, making it a potential candidate for cancer biomarker evaluation. PMID: 25053991
Database Links

HGNC: 41907

KEGG: hsa:256227

UniGene: Hs.729825

Protein Families
STEAP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of STEAP1 and how does it differ from other STEAP family members?

STEAP1 is a 339 amino acid protein characterized by six transmembrane domains with both C-terminal and N-terminal segments located in the cytosol . Unlike other STEAP family members (STEAP2-4), STEAP1 was initially thought to lack the N-terminal NADPH-binding F420H2:NADP+ oxidoreductase domain, which is essential for metalloreductase activity . This structural difference prevents STEAP1 from functioning independently as a metalloreductase due to the absence of binding sites for the electron-donating substrate NADPH .

What are the primary expression patterns of STEAP1 in normal and cancerous tissues?

STEAP1 demonstrates a highly specific expression pattern that makes it particularly valuable as a therapeutic target. In normal tissues, STEAP1 exhibits limited expression, which minimizes potential off-target effects of STEAP1-directed therapies . When examining pathological tissues, STEAP1 is highly expressed in most prostate cancers, with expression levels that correlate with disease progression .

Specifically, STEAP1 is expressed in more than 80% of metastatic castration-resistant prostate cancer cases with bone or lymph node involvement . Expression is elevated across all stages of prostate cancer, with particularly high expression in metastatic lesions to the bone and lymph nodes . Importantly, high levels of STEAP1 expression positively correlate with Gleason scores (the most reliable histological grading for prostate cancer) and poor prognoses, suggesting STEAP1's involvement in both tumor initiation and progression .

Beyond prostate cancer, STEAP1 has been reported to be significantly upregulated in lung cancer compared to normal cells, with this upregulation associated with poor prognosis . The differential expression between normal and cancerous tissues makes STEAP1 an ideal candidate for targeted therapy approaches.

How can researchers effectively produce and validate recombinant STEAP1 protein for experimental use?

Production of recombinant STEAP1 protein can be achieved through several expression systems, with wheat germ being one validated approach . The full-length human STEAP1 protein (amino acids 1-339) can be expressed and is suitable for techniques including ELISA and Western blotting . Validation of recombinant STEAP1 should include:

  • SDS-PAGE analysis with Coomassie Blue staining to confirm protein size and purity (approximately 40 kDa)

  • Western blot using anti-STEAP1 antibodies to confirm identity

  • Functional assays to assess membrane integration when expressed in cellular systems

  • If studying metalloreductase activity, fusion with NADPH-binding domains from other STEAP family members may be necessary

For researchers interested in examining the role of transmembrane regions, it's important to use expression systems capable of proper membrane protein folding and post-translational modifications. Insect cells or mammalian expression systems may provide advantages over bacterial systems for maintaining structural integrity of transmembrane regions.

What evidence supports STEAP1 as a viable target for prostate cancer therapeutics compared to other established targets?

STEAP1 possesses several characteristics that make it an exceptional therapeutic target for prostate cancer. First, STEAP1 shows broad expression across lethal metastatic prostate cancers, with studies demonstrating its expression relative to prostate-specific membrane antigen (PSMA), a more established target . This broad expression pattern is particularly important for developing therapies that can address heterogeneous tumors.

Second, STEAP1 is expressed in more than 80% of metastatic castration-resistant prostate cancer cases with bone or lymph node involvement . This high prevalence ensures that STEAP1-targeted therapies could potentially benefit a substantial proportion of patients with advanced disease.

Third, STEAP1's expression correlates with disease progression and Gleason score, making it relevant across the spectrum of prostate cancer, from early to advanced disease . This correlation with disease severity suggests that STEAP1 plays a functional role in cancer progression rather than being a passive biomarker.

Fourth, STEAP1 has limited expression in normal tissues, reducing the risk of off-target effects . This tumor specificity, combined with its cell surface location, makes it ideal for targeted therapy approaches like antibody-drug conjugates and CAR T cells.

Finally, functional studies have demonstrated that knockdown of STEAP1 induces apoptosis and inhibits proliferation in prostate cancer cells, indicating that STEAP1 is not merely a biomarker but plays an active role in cancer cell survival and growth .

What therapeutic modalities targeting STEAP1 have shown the most promise in preclinical and clinical studies?

Several therapeutic approaches targeting STEAP1 have demonstrated promising results:

  • Antibody-Drug Conjugates (ADCs): DSTP3086S, a STEAP1-targeting ADC, has shown acceptable safety and potential benefit for patients with STEAP1-expressing metastatic castration-resistant prostate cancer in a phase I clinical trial . Of 77 patients treated, 11 met the response criteria of PSA reduction ≥50%, while 26 out of 46 patients with evaluable disease at baseline presented clinical response (two partial responses; 24 stable disease) .

  • Chimeric Antigen Receptor (CAR) T Cell Therapy: Preclinical studies have demonstrated significant promise for STEAP1 CAR T cells. These engineered T cells have shown:

    • Reactivity even with low antigen density tumors

    • Antitumor activity across multiple metastatic prostate cancer models

    • Safety in human STEAP1 knock-in mouse models

    • High transduction efficiency and polyfunctionality

    • Expansion and infiltration into the tumor microenvironment both in vivo and in vitro

  • Bispecific T-cell Engagers (BiTEs): BC261, a rehumanized STEAP1-IgG bispecific for STEAP1 and CD3, has demonstrated significant elevation of T-cell infiltration and tumor ablation in EWS-family tumors and prostate cancer cell lines in preclinical studies .

  • Monoclonal Antibodies: Monoclonal antibodies against STEAP1 have been found to inhibit intercellular communication in vitro and suppress proliferation of tumor xenografts in prostate cancer models .

  • T cells expressing engineered T cell receptors (TCR-T cells): This approach has shown promise in preclinical development for STEAP1-targeting therapies .

What molecular mechanisms explain the efficacy of STEAP1-targeted therapies in different cancer types?

The efficacy of STEAP1-targeted therapies across different cancer types can be explained through several molecular mechanisms:

  • In Prostate Cancer: STEAP1 knockdown induces apoptosis and inhibits proliferation in prostate cancer cells . Additionally, STEAP1's high expression in metastatic lesions makes it an effective target for addressing advanced disease . The correlation between STEAP1 expression and Gleason scores suggests its involvement in aggressive disease phenotypes .

  • In Lung Cancer: STEAP1 upregulation potentially regulates tumor progression via multiple oncogenic pathways, including homologous recombination, p53 signaling, cell cycle, DNA replication, and apoptosis . Furthermore, STEAP1 regulates epithelial-mesenchymal transition (EMT) via the JAK2/STAT3 signaling pathway, which is often implicated in various tumors and involved in oncogenesis . STEAP1 also promotes endothelial cell migration and tube formation, suggesting a role in tumor angiogenesis .

  • In Other Cancers: STEAP1 increases cell proliferation, migration, and invasion via the AKT/FOXO1 pathway and promotes EMT . It is also translationally induced during peritoneal metastasis and can drive both tumorigenesis and chemoresistance to docetaxel .

  • Immunological Mechanisms: The efficacy of immunotherapeutic approaches targeting STEAP1 (such as CAR T cells) can be enhanced by combination with tumor-localized interleukin-12 (IL-12) therapy. This combination remodels the immunologically cold tumor microenvironment of prostate cancer and combats STEAP1 antigen escape through the engagement of host immunity and epitope spreading .

These various mechanisms explain why STEAP1-targeted therapies can be effective across different cancer types and suggest potential combination strategies to enhance efficacy.

What animal models are most appropriate for studying STEAP1-targeted therapies?

Several animal models have been developed and validated for studying STEAP1-targeted therapies:

  • Human STEAP1 Knock-in (hSTEAP1-KI) Mice: These transgenic mice express human STEAP1 instead of murine STEAP1, providing a valuable model for assessing both efficacy and safety of STEAP1-targeted therapies . Researchers have identified human STEAP1 expression in the prostate and adrenal gland of male hSTEAP1-KI mice, with expression specifically localized to luminal prostate epithelial cells and adrenal cortical cells . This model allows for assessment of potential off-target toxicity in normal tissues expressing STEAP1.

  • Xenograft Models: Various human prostate cancer cell lines expressing STEAP1 have been used to establish xenograft models in immunodeficient mice. These models are particularly useful for assessing the efficacy of STEAP1-targeted therapies against human prostate cancer cells . Both subcutaneous and orthotopic xenograft models have been utilized.

  • Murinized STEAP1 CAR Models: Researchers have generated murinized STEAP1 CAR constructs that, when combined with human STEAP1 knock-in mice, enable the definition of antitumor efficacy and off-tumor toxicity .

  • Metastatic Prostate Cancer Models: These models are particularly relevant for studying STEAP1-targeted therapies, as STEAP1 is highly expressed in metastatic castration-resistant prostate cancer . Models that recapitulate bone and lymph node metastases are especially valuable.

When selecting an animal model, researchers should consider factors such as STEAP1 expression levels, tumor microenvironment characteristics, and the specific therapeutic modality being tested. For immunotherapeutic approaches, models with intact immune systems (such as humanized mice or syngeneic models) are preferable to better assess immune-mediated effects.

What experimental methods can effectively measure STEAP1 expression and function in cell culture and tissue samples?

Researchers can employ several methodologies to measure STEAP1 expression and function:

  • Protein Expression Analysis:

    • Immunohistochemistry (IHC): Validated for detecting STEAP1 in prostate cancer specimens with varying Gleason scores

    • Western blotting: Using specific anti-STEAP1 antibodies to detect protein levels

    • Flow cytometry: Particularly useful for quantifying cell surface expression levels

    • ELISA: Applicable for recombinant STEAP1 protein analysis

  • mRNA Expression Analysis:

    • RT-qPCR: For quantifying STEAP1 mRNA levels

    • RNA-Seq: For comprehensive transcriptomic analysis

    • In situ hybridization: For localizing STEAP1 expression in tissue samples

  • Functional Assays:

    • Metalloreductase activity assays: Especially when STEAP1 is fused with NADPH-binding domains

    • Cell proliferation assays: Following STEAP1 knockdown or overexpression

    • Migration and invasion assays: To assess the impact of STEAP1 on cell motility

    • Apoptosis assays: To evaluate the effect of STEAP1 modulation on cell survival

  • Novel Biomarker Approaches:

    • Analysis of STEAP1-positive extracellular vesicles in plasma, which has shown significant association with prostate cancer diagnoses

  • Pathway Analysis:

    • Phosphorylation status of AKT/FOXO1 or JAK2/STAT3 to assess downstream signaling affected by STEAP1

    • EMT marker expression to evaluate STEAP1's impact on this process

When designing experiments, it's important to include appropriate positive and negative controls, validate antibody specificity, and consider the cellular localization of STEAP1 (membrane-bound) when preparing samples.

How can researchers effectively design and evaluate STEAP1-targeting CAR T cell therapies?

Designing and evaluating STEAP1-targeting CAR T cell therapies requires a systematic approach:

  • CAR Design Considerations:

    • Antibody Selection: Choose antibodies with high specificity and affinity for STEAP1

    • Co-stimulatory Domains: Second-generation anti-STEAP1 CARs with 4-1BB co-stimulatory domains have shown promise in preclinical studies

    • Vector Selection: Optimize for high and stable transduction efficiency

    • Spacer/Hinge Optimization: Consider the membrane-proximal location of STEAP1 epitopes

  • In Vitro Evaluation:

    • Cytotoxicity Assays: Test against cell lines with varying STEAP1 expression levels to assess sensitivity and specificity

    • Cytokine Production: Measure IL-2, IFN-γ, TNF-α to assess T cell functionality

    • Exhaustion Markers: Monitor PD-1, TIM-3, LAG-3 expression to assess T cell persistence potential

    • Low Antigen Density Testing: Evaluate reactivity against targets with low STEAP1 expression levels

    • Polyfunctionality Assessment: Measure multiple functions simultaneously, as polyfunctionality has been associated with clinical outcomes in anti-CD19 CARs

  • In Vivo Evaluation:

    • Efficacy Studies: Test in xenograft models of metastatic prostate cancer

    • Safety Studies: Use human STEAP1 knock-in mice to assess potential off-target toxicity

    • CAR T Cell Trafficking: Monitor expansion and infiltration into the tumor microenvironment

    • Tumor Microenvironment Analysis: Assess changes in immune cell populations and cytokine profiles

  • Addressing Potential Resistance Mechanisms:

    • STEAP1 Antigen Escape: This has been identified as a recurrent mechanism of treatment resistance

    • Combination Strategies: Consider combining with tumor-localized IL-12 therapy (e.g., collagen binding domain-IL-12 fusion protein) to enhance efficacy and combat antigen escape

    • Tumor Antigen Processing and Presentation: Diminished processing and presentation have been associated with STEAP1 antigen escape

  • Clinical Translation Considerations:

    • Manufacturing Protocol Optimization: Ensure high transduction efficiency and cell product quality

    • Patient Selection Biomarkers: Develop methods to identify patients most likely to benefit

    • Monitoring Strategies: Plan for tracking CAR T cell persistence, expansion, and potential toxicities

How does STEAP1 antigen escape occur during immunotherapy, and what strategies can mitigate this resistance mechanism?

STEAP1 antigen escape represents a significant challenge in STEAP1-targeted immunotherapies, particularly with CAR T cell approaches. The mechanism and potential mitigation strategies include:

Mechanisms of Antigen Escape:

  • Diminished Tumor Antigen Processing and Presentation: Research has demonstrated that STEAP1 antigen escape is associated with reduced processing and presentation of tumor antigens . This suggests a broader immune evasion strategy rather than simply loss of the target antigen.

  • Selection Pressure: CAR T cell therapy can create strong selection pressure favoring cancer cells with lower or absent STEAP1 expression.

  • Transcriptional Downregulation: Epigenetic mechanisms may lead to silencing of STEAP1 expression.

  • Alternative Splicing: Generation of STEAP1 isoforms that lack the epitope recognized by the therapeutic agent.

Mitigation Strategies:

  • Tumor-Localized IL-12 Therapy: The application of collagen binding domain (CBD)-IL-12 fusion protein combined with STEAP1 CAR T cell therapy has shown promise in enhancing antitumor efficacy by:

    • Remodeling the immunologically cold tumor microenvironment of prostate cancer

    • Combating STEAP1 antigen escape through engagement of host immunity

    • Promoting epitope spreading to additional tumor antigens

  • Multi-Target Approaches: Developing CAR T cells that simultaneously target STEAP1 and other prostate cancer antigens (such as PSMA) could reduce the likelihood of complete antigen escape.

  • Targeting Multiple Epitopes: Designing CARs that recognize different epitopes of STEAP1 could reduce the impact of single epitope loss.

  • Modulating the Tumor Microenvironment: Combining STEAP1-targeted therapies with agents that enhance antigen presentation or reduce immunosuppression could help maintain target expression and recognition.

  • Periodic Assessment of STEAP1 Expression: Monitoring changes in STEAP1 expression during treatment could guide adaptive therapeutic strategies.

This area represents a critical frontier in STEAP1-targeted immunotherapies, as understanding and overcoming antigen escape will be essential for developing durable responses in patients.

What is the comparative efficacy of different co-stimulatory domains in STEAP1 CAR T cell design?

The selection of co-stimulatory domains is a critical factor in CAR T cell design that significantly influences expansion, persistence, and anti-tumor activity. For STEAP1 CAR T cells, several considerations are important:

4-1BB Co-stimulatory Domain:

  • Preclinical studies have tested second-generation anti-STEAP1 CARs with the 4-1BB co-stimulatory domain with promising results

  • 4-1BB-containing CARs typically demonstrate:

    • Enhanced T cell persistence

    • Improved metabolic fitness through promotion of oxidative phosphorylation

    • Reduced T cell exhaustion compared to CD28-based CARs

    • Potentially slower but more sustained expansion kinetics

CD28 Co-stimulatory Domain:

  • CD28-based CARs generally show:

    • More rapid expansion and cytokine production

    • Higher initial cytotoxicity

    • Greater reliance on glycolytic metabolism

    • Potentially shorter persistence than 4-1BB CARs

Other Co-stimulatory Options:

  • OX40 and ICOS domains may offer alternative options with distinct properties

  • Third-generation CARs combining multiple co-stimulatory domains (e.g., CD28 and 4-1BB) could potentially harness benefits of both

Considerations Specific to STEAP1 Targeting:

  • The optimal co-stimulatory domain may depend on STEAP1 expression levels in target tissues

  • For low antigen density scenarios, 4-1BB domains may be advantageous as they:

    • Require lower levels of antigenic stimulation for activation

    • Provide more sustained signaling with limited antigen engagement

    • Reduce activation-induced cell death with repeated stimulation

Experimental Comparison Approaches:

  • Direct head-to-head testing of identical STEAP1-binding domains with different co-stimulatory elements

  • Assessment across multiple parameters:

    • Cytokine production profile (Th1 vs. Th2)

    • Persistence in circulation and tumor

    • Memory phenotype development

    • Exhaustion marker expression

    • Metabolic characteristics

    • Anti-tumor efficacy in vivo

Given the promising results with 4-1BB-containing STEAP1 CARs and their demonstrated reactivity even with low antigen density , this co-stimulatory domain currently appears to be a leading candidate for STEAP1 CAR development, though comparative studies with other domains would provide valuable insights.

How do STEAP1 and STEAP1B differ in structure, function, and therapeutic targeting potential?

The comparison between STEAP1 and STEAP1B represents an important area for investigation that has not been extensively characterized in the current literature. Based on available information and general principles of protein family members, we can outline key considerations:

Structural Comparison:

  • STEAP1 is a 339 amino acid protein with six transmembrane domains and cytosolic N- and C-termini

  • STEAP1B likely shares the six transmembrane topology characteristic of the STEAP family

  • Sequence homology analysis would reveal conservation of key functional domains and potential structural differences

  • Comparative modeling could predict differences in membrane topology or protein-protein interaction interfaces

Functional Comparison:

  • STEAP1 lacks intrinsic metalloreductase activity due to the absence of NADPH-binding sites but can gain this function when fused to the NADPH-binding domain of STEAP4

  • STEAP1 has established roles in:

    • Cell proliferation and survival

    • Migration and invasion

    • Epithelial-mesenchymal transition

    • Signaling through AKT/FOXO1 and JAK2/STAT3 pathways

  • STEAP1B's functions may overlap with STEAP1 but could also include unique activities or tissue-specific roles

  • Comparative functional analysis through knockout/knockdown studies would help delineate specific roles

Expression Pattern Differences:

  • STEAP1 is highly expressed in prostate cancer and metastatic lesions, with limited normal tissue expression

  • STEAP1B may have distinct tissue distribution or cancer-specific expression patterns

  • Differential expression analysis across normal and cancer tissues would identify unique therapeutic opportunities

  • Single-cell RNA sequencing could reveal cell type-specific expression patterns

Therapeutic Targeting Considerations:

  • Epitope mapping to identify unique regions in STEAP1B compared to STEAP1 would be crucial for specific targeting

  • Cross-reactivity assessment of STEAP1-targeted therapies with STEAP1B would determine specificity

  • Development of dual-targeting approaches could potentially address heterogeneity in target expression

  • STEAP1B-specific targeting might offer advantages if its expression pattern provides better tumor specificity than STEAP1

Research Priorities:

  • Comprehensive expression profiling of STEAP1B across normal and cancer tissues

  • Functional characterization through gene editing approaches

  • Generation of specific antibodies/probes for distinguishing STEAP1 from STEAP1B

  • Assessment of potential redundancy or compensation mechanisms between family members

This comparative analysis highlights the need for dedicated research on STEAP1B to fully understand its potential as a therapeutic target relative to the better-characterized STEAP1.

What bioinformatic approaches can identify potential resistance mechanisms to STEAP1-targeted therapies?

Comprehensive bioinformatic analyses can illuminate resistance mechanisms to STEAP1-targeted therapies:

  • Single-Cell RNA Sequencing Analysis:

    • Comparing pre-treatment and post-resistance tumor samples to identify transcriptional changes

    • Characterizing cell populations with differential STEAP1 expression

    • Identifying alternative pathways activated in STEAP1-low cells

    • Revealing transcriptional regulators of STEAP1 expression

  • Epigenetic Profiling:

    • Analysis of DNA methylation patterns in the STEAP1 promoter region

    • Chromatin accessibility assessment (ATAC-seq) to identify regulatory element changes

    • Histone modification mapping to understand epigenetic silencing mechanisms

  • Proteomic Approaches:

    • Phosphoproteomic analysis to identify activated signaling pathways in resistant cells

    • Protein-protein interaction mapping to understand STEAP1 regulation

    • Surface proteome characterization to identify alternative targets in resistant populations

  • Genomic Analysis:

    • Whole exome/genome sequencing to identify mutations in STEAP1 or related pathways

    • Copy number variation analysis to detect STEAP1 gene deletions

    • Structural variant calling to identify gene fusions or rearrangements

  • Pathway Enrichment Analysis:

    • Gene Ontology (GO) and pathway analyses similar to those that identified STEAP1's involvement in homologous recombination, p53 signaling, cell cycle, and DNA replication

    • Identification of bypass pathways activated in STEAP1-targeted therapy resistance

  • Machine Learning Approaches:

    • Predictive modeling of therapy response based on multi-omic profiles

    • Feature importance analysis to identify key resistance determinants

    • Network analysis to map resistance pathway interactions

  • Comparative Analysis with Other Targeted Therapies:

    • Leveraging resistance mechanisms identified in other cancer immunotherapies

    • Cross-referencing with known resistance pathways in prostate cancer

  • Spatial Transcriptomics:

    • Mapping resistance mechanism activation in relation to tumor microenvironment features

    • Identifying spatial heterogeneity in STEAP1 expression and resistance factors

These approaches can help identify mechanisms such as diminished tumor antigen processing and presentation, which has been associated with STEAP1 antigen escape during CAR T cell therapy , and inform combination strategies to overcome resistance.

How can researchers accurately quantify STEAP1 surface expression for patient stratification in clinical trials?

Accurate quantification of STEAP1 surface expression is critical for patient stratification in clinical trials of STEAP1-targeted therapies. Several methodological approaches can be employed:

  • Immunohistochemistry (IHC):

    • Standard approach for clinical tissue samples

    • Semi-quantitative scoring (e.g., H-score, Allred score) to grade intensity and percentage of positive cells

    • Multiplex IHC to simultaneously assess STEAP1 with other biomarkers

    • Digital pathology with automated image analysis for more objective quantification

    • Standardization considerations:

      • Validated antibody selection with confirmed specificity

      • Consistent staining protocols across trial sites

      • Central pathology review to minimize inter-observer variability

  • Flow Cytometry:

    • Applicable for fresh tissue or circulating tumor cells

    • Quantitative assessment of surface expression using calibration beads

    • Mean/median fluorescence intensity (MFI) measurement

    • Multiparameter analysis to identify specific cell populations

    • Considerations:

      • Fresh tissue requirements may limit applicability

      • Need for consistent sample processing protocols

      • Instrument calibration across sites

  • Mass Cytometry (CyTOF):

    • Higher parameter analysis than conventional flow cytometry

    • Minimal spectral overlap allows for more comprehensive panel design

    • Metal-conjugated antibodies provide quantitative readout

  • Liquid Biopsy Approaches:

    • Analysis of STEAP1-positive extracellular vesicles in plasma, which has shown significant association with prostate cancer diagnoses

    • Potential for less invasive longitudinal monitoring

    • Standardization of isolation and quantification methods required

  • Quantitative Imaging:

    • Immuno-PET using radiolabeled anti-STEAP1 antibodies

    • Provides whole-body assessment of target expression

    • May be particularly valuable for heterogeneous tumors

  • Molecular Quantification:

    • RT-qPCR for STEAP1 mRNA with appropriate normalization

    • Digital droplet PCR for absolute quantification

    • RNA-Seq with appropriate normalization and quality metrics

  • Reference Standards and Controls:

    • Cell lines with defined STEAP1 expression levels as controls

    • Recombinant STEAP1 protein standards for assay calibration

    • Inclusion of both positive and negative control tissues

The optimal approach for clinical trials would likely involve a combination of methods, with IHC as the primary stratification tool supplemented by more quantitative approaches. Establishing clear threshold criteria for "STEAP1-positive" status is essential, potentially using receiver operating characteristic (ROC) analysis from early-phase trial data to define clinically relevant cutoffs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.