Recombinant Human Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (NSDHL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (NSDHL)

Recombinant Human Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating, commonly referred to as NSDHL, is an enzyme crucial in the cholesterol biosynthesis pathway. It is involved in the sequential removal of two C-4 methyl groups in post-squalene cholesterol biosynthesis, acting as a sterol dehydrogenase or decarboxylase . NSDHL is encoded by the NSDHL gene located on the X chromosome and plays a significant role in various biological processes, including cholesterol synthesis and epidermal growth factor receptor (EGFR) trafficking pathways .

Function and Localization

NSDHL is primarily localized to the endoplasmic reticulum (ER) membrane, where it catalyzes the NAD(P)(+)-dependent oxidative decarboxylation of the C4 methyl groups of 4-alpha-carboxysterols . Additionally, NSDHL has been found to associate with lipid droplets, which are ER-derived structures containing neutral lipids. This dual localization may contribute to the regulation of intracellular cholesterol levels and distribution .

Clinical Significance

Mutations in the NSDHL gene are associated with congenital hemidysplasia with ichthyosiform nevus and limb defects (CHILD syndrome), an X-linked disorder that is lethal in males . In humans, deletions or mutations in the NSDHL gene can lead to severe developmental abnormalities, including limb defects and skin lesions . In animals, similar mutations have been identified, such as in Labrador Retrievers, where a large deletion in the NSDHL gene results in an X-linked semidominant disorder .

Research Findings and Inhibitors

Recent studies have focused on the crystal structure of NSDHL, providing insights into its coenzyme-binding site and conformational changes upon coenzyme binding . These structural details have facilitated the development of novel inhibitors targeting NSDHL, which could be useful in treating cholesterol-related diseases and certain carcinomas . For instance, FR171456 is a natural product known to inhibit NSDHL, affecting cholesterol synthesis and potentially impacting viral replication pathways .

Table 2: Clinical Associations of NSDHL Mutations

ConditionDescription
CHILD SyndromeCongenital hemidysplasia with ichthyosiform nevus and limb defects, X-linked lethal in males
Labrador Retriever DisorderX-linked semidominant disorder due to a large deletion in the NSDHL gene

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
NSDHL; H105E3; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating; Protein H105e3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NSDHL
Target Protein Sequence
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLAR GYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRV NYIGTKNVIETCKEAGVQKLILTSSASVIFEGVDIKNGTEDLPYAMKPIDYYTETKILQE RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFV ENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYWVA YYLALLLSLLVMVISPVIQLQPTFTPMRVALAGTFHYYSCERAKKAMGYQPLVTMDDAME RTVQSFRHLRRVK
Uniprot No.

Target Background

Function

Recombinant Human Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (NSDHL) catalyzes the NAD(P)(+)-dependent oxidative decarboxylation of the C4 methyl groups of 4-alpha-carboxysterols in post-squalene cholesterol biosynthesis. It also plays a role in regulating the endocytic trafficking of EGFR.

Gene References Into Functions
  1. Case study of a 9-year-old Chinese girl with CHILD syndrome, revealing a heterozygous point mutation in exon 8 of the NSDHL gene. PMID: 26459993
  2. Expansion of the NSDHL mutation spectrum in CHILD syndrome, highlighting the potential frequency of large exon deletions. PMID: 26014843
  3. Identification of a novel missense mutation in the NSDHL gene causing CK syndrome in a Lithuanian family using targeted next-generation sequencing. PMID: 25900314
  4. Expression of human NSDHL protein and mouse Nsdhl mRNA in cholesterol and steroid-synthesizing tissues and peripheral tissues affected by CHILD or CK syndromes. PMID: 22113624
  5. Observation of CKS in males with intellectual disability from a family with an NSDHL mutation (c.1098 dup [p.Arg367SerfsX33]). PMID: 21129721
  6. Detection of a missense mutation in the NSDHL gene in CHILD syndrome. PMID: 19906044
  7. Rescue of lethal Nsdhl deficiency in mouse embryos through transgenic expression of human Nsdhl. PMID: 19880419
  8. Localization of NAD(P)H steroid dehydrogenase-like protein to lipid droplets. PMID: 12837764
  9. Golgi trafficking and accumulation of NSDHL, a cholesterol synthesis enzyme, on ER membranes and lipid droplet surfaces. PMID: 14506130
  10. Microarray analysis of gene expression related to NSDHL sterol dehydrogenase in embryonic fibroblasts. PMID: 15805545
  11. Identification of a novel missense mutation (R199H) in exon 6 of the NSDHL gene in a subset of sporadic verruciform xanthomas. PMID: 16230564
  12. Design and testing of NSDHL-shRNA sequences. PMID: 17498944
Database Links

HGNC: 13398

OMIM: 300275

KEGG: hsa:50814

STRING: 9606.ENSP00000359297

UniGene: Hs.57698

Involvement In Disease
Congenital hemidysplasia with ichthyosiform erythroderma and limb defects (CHILD); CK syndrome (CKS)
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Lipid droplet.
Tissue Specificity
Brain, heart, liver, lung, kidney, skin and placenta.

Q&A

How do mutations in the NSDHL gene manifest clinically and what research approaches are used to study genotype-phenotype correlations?

NSDHL mutations cause CHILD syndrome (Congenital hemidysplasia with ichthyosiform erythroderma and limb defects), an X-linked dominant disorder that is typically lethal in males . The condition primarily exhibits strictly unilateral congenital hemidysplasia with ichthyosiform erythroderma and ipsilateral limb defects in female individuals .

Research approaches for studying genotype-phenotype correlations include:

MethodologyApplicationKey Findings
Trio whole-exome sequencingIdentification of novel NSDHL mutationsRevealed recurrent male fatality due to novel mutations
Next-generation sequencingMolecular confirmation of clinical diagnosesIdentified more than 30 different pathogenic variants
ImmunohistochemistryAnalysis of affected tissuesRevealed verruciform xanthomas and ptychotropism
Topical treatment trialsTherapeutic approaches2% lovastatin/2% cholesterol combinations effectively treat cutaneous lesions

Most NSDHL mutations are single nucleotide substitutions, with 13 missense, seven nonsense, two splice sites, and one substitution in the 3' untranslated region documented in the Human Gene Mutation Database . Multi-exon deletions and small insertions have also been identified .

Notably, while classic presentations involve extensive unilateral involvement, milder forms with minimal skin and limb manifestations have been reported, sometimes with gastrointestinal symptoms including multiple whitish plaques in the proximal duodenum, stomach, and distal esophagus .

What are the optimal expression systems and purification protocols for producing functional recombinant human NSDHL protein?

The production of functional recombinant human NSDHL requires careful consideration of expression systems and purification protocols to maintain enzymatic activity and proper folding.

Expression Systems:

SystemAdvantagesApplicationsReference
E. coliHigh yield, cost-effectiveStructural studies, enzymatic assays
Wheat germEnhanced eukaryotic foldingELISA, Western blotting

For E. coli expression, researchers commonly use:

  • Vector: pET21a with NdeI and XhoI restriction sites

  • Host strain: BL21(DE3) or equivalent

  • Induction: IPTG at optimal concentrations

  • Growth temperature: Often lowered to 16-18°C during induction to improve solubility

For wheat germ expression systems, full-length protein (1-373 aa) can be produced and is suitable for immunological applications like ELISA and Western blotting .

How does the subcellular localization of NSDHL impact its function and what techniques are used to study its trafficking?

NSDHL exhibits a dual localization pattern that is critical to its function:

  • Endoplasmic reticulum (ER) membranes - common for enzymes of post-squalene cholesterol biosynthesis

  • Lipid droplets - ER-derived cytoplasmic structures with a neutral lipid core

This dual localization likely provides a mechanism for regulating both the levels and sites of accumulation of intracellular cholesterol .

Research techniques for studying NSDHL trafficking include:

  • Confocal microscopy of tagged proteins (wild-type and mutant NSDHL)

  • Subcellular fractionation and Western blotting

  • Golgi disruption experiments (demonstrate that trafficking through the Golgi is necessary for ER membrane localization)

  • Colocalization studies with organelle-specific markers

Studies with murine Nsdhl alleles have demonstrated that NSDHL first traffics through the Golgi apparatus before localizing to ER membranes . This trafficking pathway is essential for proper protein function, as disruptions to this process can affect cholesterol biosynthesis efficiency.

For researchers studying NSDHL localization, it's important to note that C-terminal tags may impact lipid droplet association, making the choice of tagging strategy critical for accurate localization studies .

What roles does NSDHL play in cancer biology and what experimental approaches reveal these functions?

NSDHL has emerged as an important player in cancer biology through multiple mechanisms:

  • Regulation of EGFR trafficking and signaling pathways

  • Maintenance of cancer stem cell populations

  • Modulation of tumor-initiating capacity

Experimental approaches to study NSDHL in cancer:

TechniqueApplicationKey Findings
siRNA/shRNA knockdownGene silencing in cancer cellsReduces sphere formation and cancer stem cell markers
3D tumorsphere cultureCancer stem cell assaysNSDHL knockdown reduces tightly cohesive sphere formation
RNA-seqTranscriptomic analysisKnockdown affects 617 DEGs, enriched in TGF-β signaling and cell cycle pathways
Flow cytometryStem cell marker analysisReduced CD44+/CD24- phenotype and ALDH activity after NSDHL knockdown
Xenograft modelsIn vivo tumor studiesNSDHL knockdown suppresses tumor initiation and growth

In breast cancer specifically, NSDHL knockdown reduces the population of breast cancer stem cells with CD44+/CD24- phenotype and high ALDH activity, as well as luminal progenitors with CD49f+/EpCAM+ phenotype . This is accompanied by decreased TGF-β1, TGF-β3, and GLI1 expression in tumorspheres .

NSDHL also regulates EGFR protein turnover and signaling cascades, leading to sensitization to EGFR kinase inhibitors like erlotinib in both erlotinib-sensitive and erlotinib-resistant cancer cell lines . This suggests that NSDHL inhibition could be a potential strategy to overcome resistance to EGFR-targeted therapies.

How do crystal structures of human NSDHL inform inhibitor design and what progress has been made in developing selective NSDHL inhibitors?

The crystal structures of human NSDHL have provided crucial insights for rational inhibitor design:

How do in vitro and in vivo models of NSDHL function compare and what are the methodological considerations for each approach?

Comparing in vitro and in vivo approaches reveals important differences in studying NSDHL function:

In vitro approaches:

  • Recombinant protein studies with purified NSDHL

  • Cell culture models (e.g., FE1 lung epithelial cells, cancer cell lines)

  • Enzyme activity assays

  • Tumorsphere formation assays for cancer stem cell studies

  • Transcriptomic and proteomic analyses in cultured cells

In vivo approaches:

  • Mouse models (e.g., HFD-fed obese mice, hypoxia exposure)

  • Xenograft tumor models using immunodeficient mice

  • Analysis of tissue-specific NSDHL expression and function

  • Physiological assessment of cholesterol metabolism

  • Proteomic analysis of tissues (e.g., testis samples)

Comparative studies have shown generally poor concordance between in vitro and in vivo biological responses . While similarities may exist at the pathway level, the specific genes altered under these pathways are often different, suggesting distinct underlying mechanisms between cells in culture and live tissue .

For example, research comparing multiwalled carbon nanotube exposure found that in vivo studies showed strong dose-dependent activation of acute phase and inflammation response in mouse lungs, while in vitro studies revealed effects on core cellular functions including transcription, cell cycle, and cellular growth and proliferation .

What genetic testing approaches are used for NSDHL mutations and what are the clinical implications of different mutation types?

Genetic testing for NSDHL mutations involves several methodological approaches with important clinical implications:

Testing approaches:

MethodApplicationAdvantages
Biochemical testingPreliminary diagnosisCan identify NSDHL deficiency or CHILD syndrome
Next-generation sequencingComprehensive mutation analysisCan detect various mutation types across the gene
Trio whole-exome sequencingComplex cases, recurrent male fatalityIdentifies novel mutations and inheritance patterns
Targeted mutation analysisFamily studies after proband identificationFaster, more economical for known mutations

The recommended testing strategy involves:

  • Biochemical testing of the individual with suspected NSDHL-related disorder

  • Genetic testing to confirm biochemical findings

  • Targeted genetic analysis for other family members once a mutation is identified

Clinical implications of mutation types:

NSDHL mutations lead to several disorders with distinct clinical features:

  • CHILD syndrome (X-linked dominant)

    • Predominantly affects females (lethal in males)

    • Characterized by unilateral ichthyosiform erythroderma and limb defects

    • Can present with minimal skin and limb involvement in milder cases

    • May include gastrointestinal manifestations

  • CK syndrome (X-linked recessive)

    • Affects mostly males

    • Characterized by cognitive impairment, seizures, microcephaly, cerebral cortical malformations, and dysmorphic facial features

Importantly, genetic testing results rarely predict disease severity, and negative results don't exclude a diagnosis. Some mutations may yield inconclusive results, reflecting current limitations in knowledge and techniques .

What role does NSDHL play in the regulation of EGFR trafficking and signaling, and how can this be targeted therapeutically?

NSDHL has emerged as a critical regulator of EGFR trafficking and signaling:

Mechanistic insights:

  • NSDHL regulates the endocytic trafficking of EGFR

  • Loss of NSDHL gene expression sensitizes cancer cells to EGFR-targeting inhibitors

  • NSDHL inhibition can alter EGFR protein turnover and suppress EGFR signaling cascades

Experimental approaches to study NSDHL-EGFR interactions:

  • NSDHL knockdown via siRNA/shRNA in cancer cell lines

  • Analysis of EGFR protein levels, localization, and phosphorylation

  • Assessment of downstream signaling pathways (Western blot, phospho-protein arrays)

  • Combined treatment with NSDHL inhibitors and EGFR kinase inhibitors

How does NSDHL function in cholesterol homeostasis beyond its enzymatic role and what methodologies reveal these additional functions?

Beyond its direct enzymatic role in cholesterol biosynthesis, NSDHL contributes to cholesterol homeostasis through several additional mechanisms:

Multiple functions of NSDHL:

  • Regulation of lipid droplet biology through surface association

  • Potential role in cholesterol trafficking between cellular compartments

  • Involvement in sterol-dependent signaling pathways

  • Impact on membrane organization and fluidity

Methodological approaches to study these functions:

TechniqueApplicationFindings
Confocal microscopySubcellular localizationNSDHL associates with both ER membranes and lipid droplets
Trafficking inhibitionProtein transport pathwaysNSDHL requires Golgi trafficking for ER membrane localization
Metabolic labelingCholesterol movementTracks cholesterol transport between compartments
LipidomicsGlobal lipid changesIdentifies alterations in lipid profiles beyond cholesterol
Membrane biophysicsFluidity measurementsAssesses impact on membrane properties

The dual localization of NSDHL within ER membranes and on the surface of lipid droplets provides a mechanism for regulating both the levels and sites of accumulation of intracellular cholesterol . This spatial regulation may represent an important aspect of cellular cholesterol homeostasis beyond the enzymatic function of NSDHL.

In CHILD syndrome, the combination of cholesterol deficiency and accumulation of toxic sterol intermediates appears to contribute to the pathology, as evidenced by the success of combination topicals containing cholesterol and statins (2% lovastatin / 2% cholesterol) in treating cutaneous lesions . This suggests a complex interplay between different aspects of NSDHL function in maintaining proper cholesterol balance in tissues.

Understanding these broader functions requires integrated experimental approaches that combine biochemical, cellular, and systems biology techniques to build a comprehensive picture of NSDHL's role in cholesterol homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.