Recombinant Human Sterol O-acyltransferase 1 (SOAT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: Our standard shipping includes blue ice packs. If dry ice is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SOAT1; ACACT; ACACT1; ACAT; ACAT1; SOAT; STAT; Sterol O-acyltransferase 1; Acyl-coenzyme A:cholesterol acyltransferase 1; ACAT-1; Cholesterol acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEE LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGK IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK FPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPT YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF LFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFM FFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR PRSWTCRYVF
Uniprot No.

Target Background

Function
Sterol O-acyltransferase 1 (SOAT1) is an enzyme that catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. This process plays a significant role in lipoprotein assembly and dietary cholesterol absorption. SOAT1 exhibits a preference for oleoyl-CoA ((9Z)-octadecenoyl-CoA) as its substrate, demonstrating higher activity towards acyl-CoA substrates with a double bond at the delta-9 position (9Z) compared to saturated acyl-CoA or unsaturated acyl-CoA with double bonds at the delta-7 (7Z) or delta-11 (11Z) positions.
Gene References Into Functions
  1. SOAT-1 role in atherosclerosis PMID: 29567472
  2. Several residues in one subunit closely interact with the same residues in the other subunit; mutating these residues to Cys does not lead to loss in enzyme activity. Mutating residues F453, A457, or H460 to Cys causes a significant decrease in enzyme activity. PMID: 17691824
  3. An increase in in vitro ACAT1 activity is observed in PC-3 prostate cancer cells treated with androgen. PMID: 18000807
  4. The rs1044925 polymorphism in the ACAT1 gene is associated not only with serum LDL-C and nHDLC levels in healthy Chinese subjects in Chengdu area but also with HDL-C levels in subjects with endogenous hypertriglyceridemia. PMID: 18393248
  5. RNA secondary structures located in the vicinity of the GGC(1274-1276) codon are required for the production of the 56-kDa isoform. PMID: 18542101
  6. ACAT inhibition may stimulate the cholesterol-catabolic (cytochrome P450) pathway in lesion-macrophages. PMID: 18779653
  7. Angiotensin II enhances foam cell formation by upregulating ACAT1 expression predominantly through the actions of the AT(1) receptor via the G protein/c-Src/PKC/MAPK pathway in human monocyte-macrophages. PMID: 18971559
  8. Docosahexaenoic acid can act as a substrate for ACAT1. As a poor substrate, docosahexaenoic acid also inhibits the activity of ACAT1. PMID: 19217763
  9. Results suggest that the ERK, p38MAPK, and JNK signaling pathways may be involved in insulin-mediated regulation of ACAT1, but no PI3K and PLC-gamma signaling pathways were involved in the present study. PMID: 19269342
  10. Leptin accelerates cholesteryl ester accumulation in human monocyte-derived macrophages by increasing ACAT-1 expression. PMID: 19625677
  11. High ACAT1 expression is associated with estrogen receptor-negative basal-like breast cancer. PMID: 19851860
  12. Macrophages cope with cholesterol loading by using a novel mechanism: they produce more ER-derived vesicles with elevated ACAT1 enzyme activity without having to produce more ACAT1 protein. PMID: 20460577
  13. The plaque-modulating effects of K-604 can be explained by stimulation of procollagen production independent of ACAT inhibition in addition to potent inhibition of macrophage ACAT-1. PMID: 20843517
  14. Visfatin may down-regulate the ABCA1 expression and up-regulate the ACAT1 expression via the PPARgamma signal transduction pathway, which decreases the outflow of free cholesterol, increases the content of cholesterol esters, and then induces foam cell formation. PMID: 20945045
  15. In THP-1-derived macrophages and foam cells, the expression level of ACAT-1 and cellular cholesterol content increased significantly in response to asymmetric dimethylarginine treatment in a time- and concentration-dependent manner. PMID: 21177161
  16. The present study shows that the C allele carriers of ACAT-1 rs1044925 SNP in male hyperlipidemic subjects had higher serum total cholesterol, HDL-cholesterol, and ApoAI levels than the C allele noncarriers. PMID: 22243772
  17. Essential oil of Pinus koraiensis leaves significantly inhibited hACAT1 levels in HepG2 cells. PMID: 22275303
  18. Several lipid-related gene polymorphisms interact with overweight/obesity to modulate blood pressure levels. PMID: 23109900
  19. ABCA1 and ACAT1 DNA methylation induced by homocysteine may play a potential role in ABCA1 and ACAT1 expression and the accumulation of cholesterol in monocyte-derived foam cells. PMID: 23305686
  20. The molecular mechanism of insulin action is mediated via interaction of the functional IRE upstream of the ACAT1 P1 promoter with C/EBPalpha and is MAPK-dependent. PMID: 23564383
  21. The exo-endo trans-splicing is dependent on the interchromosomal region of the 4.3-kb human ACAT1 chimeric mRNA, and that the chimeric mRNA is necessary for the production of the ACAT1 56-kDa isoform. PMID: 23835473
  22. Induction of apoptosis and necroptosis by 24(S)-hydroxycholesterol is dependent on the activity of ACAT1. PMID: 24407243
  23. The enzyme activity of ACAT1 with Gln526 is less active than that of ACAT1 with Arg526 by 40%; Pro347 located near transmembrane domain 5 plays a significant role in modulating enzyme catalysis. PMID: 24517390
  24. Data show that the C allele of acyl-CoA acyltransferase-1 (ACAT-1) rs1044925 was associated with a decreased risk of coronary artery disease and ischemic stroke patients. PMID: 24577316
  25. Acat1 gene knock-out increases phagocytic uptake of amyloid beta-protein (1-42). PMID: 25339759
  26. ACAT1 regulates glioblastoma-cell proliferation via modification of the Akt and/or the ERK1/2 pathway. PMID: 26252415
  27. Our results demonstrated the contrasting effects of STC1 and STC2-derived peptides on human macrophage foam cell formation associated with ACAT1 expression and on HASMC migration. PMID: 27346255
  28. TLR4 siRNA inhibits cell proliferation, migration, and invasion by suppressing ACAT1 expression, suggesting that TLR4 may be a potential therapeutic target for the treatment of colorectal cancer. PMID: 27177773
  29. These results illustrate that ACAT1-catalyzed esterification of 24S-OHC with long-chain unsaturated fatty acid followed by formation of atypical LD-like structures at the ER membrane is a critical requirement for 24S-OHC-induced cell death. PMID: 27647838
  30. ACAT1 has a role in regulating the dynamics of free cholesterols in the plasma membrane, which leads to the APP-alpha-processing alteration. PMID: 26474739
  31. Intracranial GBM xenografts were used to determine the effects of genetically silencing SOAT1 and SREBP-1 on tumor growth. PMID: 27281560
  32. Higher Gleason grade was associated with lower LDLR expression, lower SOAT1, and higher SQLE expression. Besides high SQLE expression, cancers that became lethal despite primary treatment were characterized by low LDLR expression (odds ratio for highest versus lowest quintile, 0.37; 95% CI 0.18-0.76) and by low SOAT1 expression (odds ratio, 0.41; 95% CI 0.21-0.83). PMID: 28595267
  33. Data indicate that mitotane confers adrenal-specific cytotoxicity and down-regulates steroidogenesis by inhibition of sterol-O-acyl-transferase 1 (SOAT1) leading to lipid-induced endoplasmic reticulum (ER) stress. PMID: 26305886
  34. Suggest retinal pigment epithelium metabolism of 7-ketocholesterol occurs by esterification to fatty acids via cPLA2alpha and SOAT1 followed by selective efflux to HDL. PMID: 25617738
  35. PLA/AT-1 is at least partly responsible for the generation of N-acylphosphatidylethanolamine in mammalian cells. PMID: 23994608
  36. These studies demonstrate that both SIAE and SOAT activities seem to be responsible for the enhanced level of Neu5,9Ac(2) in lymphoblasts, which is a hallmark in acute lymphoblastic leukemia. PMID: 21803834
  37. The polymorphism of rs1044925 in the ACAT-1 gene is mainly associated with female serum total cholesterol, LDL-C, and ApoB levels in the Bai Ku Yao population. PMID: 21143839
  38. These findings suggest the potential involvement of MAPK and STAT pathways in norcantharidin-induced apoptogenesis. PMID: 21266192
  39. SF-1-dependent up-regulation of SOAT1 may be important for maintaining readily-releasable cholesterol reserves needed for active steroidogenesis and during episodes of recurrent stress. PMID: 21239516
  40. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
  41. Results show that signaling through ACAT/cholesterol esterification is a novel pathway for the CCK2R that contributes to tumor cell proliferation and invasion. PMID: 19502590
  42. Allosteric activation by cholesterol. PMID: 12533546
  43. Polymorphism of the gene encoding acyl-coenzyme A: cholesterol acyltransferase 1 (SOAT1) is involved in the regulation of beta-amyloid peptide generation, is associated with low brain amyloid load, and with low cerebrospinal fluid levels of cholesterol. PMID: 12851640
  44. ACAT-1 transcripts predominate in human liver and ACAT-2 transcripts predominate in human duodenum and support the notion that ACAT-2 has an important regulatory role in liver and intestine. PMID: 14729857
  45. Expression in monocytes infiltrating from the circulation to vascular walls may be enhanced by pre-existing transforming growth factor-beta1. PMID: 15219857
  46. A stable upstream stem-loop structure enhances selection of the first 5'-ORF-AUG as a main start codon for translation initiation of ACAT1 mRNA. PMID: 15253151
  47. Increasing DGAT1, ACAT1, or ACAT2 expression stimulates the assembly and secretion of VLDL from liver cells. PMID: 15308631
  48. A glucocorticoid response element (GRE) located within the human ACAT1 gene P1 promoter to respond to the elevation of human ACAT1 gene expression by dexamethasone could be functionally bound with glucocorticoid receptor (GR) proteins. PMID: 15353128
  49. The results of a comprehensive genetic assessment of SOAT1 variants in the NIMH AD Genetics Initiative study sample are presented. PMID: 15768051
  50. Disulfide linkage map shows that cysteine(C)92 is located on the cytoplasmic side of the endoplasmic reticulum (ER) membrane and the disulfide is located in the ER lumen, while all other free Cs are located within the hydrophobic region(s) of the enzyme. PMID: 15850387

Show More

Hide All

Database Links

HGNC: 11177

OMIM: 102642

KEGG: hsa:6646

STRING: 9606.ENSP00000356591

UniGene: Hs.445588

Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SOAT1 in cellular cholesterol metabolism?

SOAT1 (also known as ACAT) catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than free cholesterol. This esterification process serves two critical functions: it creates a storage form of cholesterol that can be packaged into lipid droplets within cells, and it facilitates cholesterol transport in secreted lipoprotein particles to other tissues. The enzyme plays a fundamental role in maintaining intracellular cholesterol homeostasis by preventing potentially toxic accumulation of free cholesterol in cell membranes .

The reaction catalyzed by SOAT1 involves the transfer of a fatty acyl group from long-chain fatty acyl-CoA to the hydroxyl group at position 3 of cholesterol. This esterification step is reversible through the action of hormone-sensitive lipase, which can hydrolyze cholesteryl esters back to free cholesterol, particularly following ACTH stimulation in steroidogenic tissues like the adrenal gland .

What is the structural organization of human SOAT1 protein?

Human SOAT1 (hSOAT1) is an endoplasmic reticulum (ER) resident, multi-transmembrane enzyme belonging to the membrane-bound O-acyltransferase (MBOAT) family. Cryo-electron microscopy studies have revealed that hSOAT1 forms a tetrameric structure composed of a dimer of dimers. Each monomer contains multiple transmembrane domains that create a catalytic chamber where substrate binding and enzymatic activity occur .

The structure at 3.5 Å resolution has identified key residues in the active site, including H460, N421, and W420, which are essential for catalytic activity. These residues are positioned within the catalytic chamber in a way that allows for interaction with both cholesterol and acyl-CoA substrates. The quaternary structure of SOAT1 appears to be important for its enzymatic function, as the tetrameric arrangement likely facilitates cooperative binding and catalysis .

Which tissues show significant expression of SOAT1?

SOAT1 exhibits varied expression across human tissues, with particularly notable expression in several key organs. Based on pubmed publications analyzing SOAT1 expression patterns, the following tissues have significant SOAT1 expression:

  • Brain - More than 6 publications document substantial SOAT1 expression in brain tissue

  • Vascular tissues - At least 2 publications confirm expression in vascular structures

  • Liver - Multiple publications (>2) demonstrate hepatic expression

  • Blood - At least 2 publications document expression in blood components

  • Heart - At least 1 publication shows cardiac expression

  • Adrenal gland - Expression confirmed in at least 1 publication, with particular importance in steroidogenesis

SOAT1 expression has also been documented in the human fetal adrenal cortex from 6 to 9 weeks postconception, suggesting an important developmental role in establishing steroidogenic capacity during fetal development .

How does SOAT1 contribute to steroidogenesis?

SOAT1 plays a critical role in adrenal steroidogenesis by regulating cholesterol availability. The enzyme catalyzes the formation of cholesteryl esters, creating stored pools of esterified cholesterol that can be readily mobilized upon hormonal stimulation. This mechanism is particularly important in steroidogenic tissues like the adrenal gland, where rapid cholesterol mobilization is necessary for hormone production .

Upon ACTH stimulation, hormone-sensitive lipase hydrolyzes these cholesteryl ester reserves, liberating free cholesterol that serves as the substrate for steroidogenic enzymes. This process ensures a readily available pool of cholesterol for steroid hormone synthesis during periods of high demand or recurrent stress. Additionally, SOAT1-mediated esterification protects adrenal cells from the potentially damaging effects of excess free cholesterol accumulation .

SOAT1 has been identified as a novel target of steroidogenic factor-1 (SF-1, NR5A1), a nuclear receptor that regulates many aspects of adrenal development and function. SF-1-dependent upregulation of SOAT1 appears to be an important mechanism for maintaining cholesterol reserves needed for active steroidogenesis .

What experimental approaches are optimal for studying SOAT1 activity in vitro?

For investigating SOAT1 enzymatic activity in vitro, several methodological approaches have proven effective:

  • Radiometric assays - These assays typically use [14C]oleoyl-CoA or [3H]cholesterol as substrates to measure the formation of cholesteryl esters. After the reaction, lipids are extracted, separated by thin-layer chromatography, and radioactivity is quantified in the cholesteryl ester fraction.

  • Fluorescence-based assays - Using fluorescent cholesterol analogs allows for real-time monitoring of esterification activity. These assays offer advantages in throughput and avoiding radioactive materials.

  • Recombinant protein systems - Purified recombinant SOAT1 incorporated into liposomes or nanodiscs provides a defined system for studying intrinsic enzymatic properties without cellular confounding factors .

  • Microsomal preparations - Microsomes isolated from cells expressing SOAT1 retain enzymatic activity and can be used to study the enzyme in its native membrane environment.

When establishing these assays, careful consideration must be given to reaction conditions, including pH, temperature, detergent concentrations, and substrate presentation methods, as SOAT1 is membrane-bound and requires an appropriate lipid environment for optimal activity .

How can recombinant human SOAT1 be expressed and purified while maintaining enzymatic activity?

Expressing and purifying enzymatically active recombinant human SOAT1 presents significant challenges due to its multiple transmembrane domains. Successful approaches include:

  • Expression systems:

    • Insect cell systems (Sf9, High Five) using baculovirus vectors have proven successful for membrane protein expression

    • Mammalian expression systems (HEK293, CHO cells) can provide appropriate post-translational modifications

    • Yeast systems (Pichia pastoris) offer advantages for scale-up but may have differences in lipid composition

  • Purification strategies:

    • Affinity tags (His, FLAG, or STREP) positioned to avoid interference with transmembrane domains

    • Detergent selection is critical - mild detergents like DDM, LMNG, or GDN have been successful for membrane protein purification

    • Lipid supplementation during purification to maintain the native environment

  • Activity preservation:

    • Addition of cholesterol or substrate analogs during purification

    • Reconstitution into nanodiscs or liposomes following purification

    • Maintaining an appropriate lipid-to-protein ratio throughout the purification process

For structural studies of SOAT1, cryo-electron microscopy has proven more successful than crystallography, allowing visualization of the protein in a more native-like environment .

What are the challenges in structural studies of human SOAT1?

Structural determination of human SOAT1 faces several significant challenges:

  • Membrane protein complexities:

    • As a multi-pass transmembrane protein, SOAT1 requires detergents or membrane mimetics for solubilization

    • The hydrophobic nature of transmembrane domains makes traditional crystallization difficult

    • Maintaining the native oligomeric state (tetramer) during purification can be challenging

  • Conformational heterogeneity:

    • SOAT1 likely undergoes significant conformational changes during its catalytic cycle

    • These dynamic states can complicate structural determination and interpretation

  • Technical limitations:

    • X-ray crystallography has proven difficult for SOAT1, likely due to conformational flexibility

    • Cryo-EM, while successful in determining the structure at 3.5 Å resolution, requires optimization to achieve resolution that reveals all mechanistic details

  • Ligand binding studies:

    • The dual-substrate nature of SOAT1 (requiring both cholesterol and acyl-CoA) complicates ligand binding studies

    • Capturing different enzymatic states may require substrate analogs or inhibitors

Despite these challenges, recent advances using cryo-EM have successfully determined the structure of human SOAT1, revealing its tetrameric arrangement and identifying the binding site for the inhibitor CI-976, which blocks accessibility to the active site residues H460, N421, and W420 .

How do post-translational modifications affect SOAT1 function?

Post-translational modifications (PTMs) of SOAT1 represent an important regulatory mechanism affecting its enzymatic activity, stability, and localization:

  • Phosphorylation:

    • SOAT1 contains multiple potential phosphorylation sites

    • Phosphorylation may modulate enzyme activity in response to cellular signaling pathways

    • Protein kinase A and protein kinase C have been implicated in regulating SOAT1 activity

  • Glycosylation:

    • N-linked glycosylation affects protein folding and stability

    • Proper glycosylation is important for SOAT1 trafficking to the endoplasmic reticulum

  • Ubiquitination:

    • Regulates SOAT1 protein levels through proteasomal degradation

    • May be involved in quality control mechanisms for misfolded protein

  • S-acylation:

    • Palmitoylation may affect membrane association and localization

    • Could influence interaction with other proteins in cholesterol-rich membrane domains

When studying SOAT1 function, researchers should consider how experimental conditions might alter these PTMs. For instance, expression in different cell types or under various stress conditions may result in different modification patterns. Mass spectrometry approaches can be employed to identify and quantify PTMs on SOAT1 under different experimental conditions.

What cell models are most appropriate for studying SOAT1 function?

The selection of appropriate cell models for SOAT1 research should be guided by the specific research questions and the biological context of interest:

  • Adrenal cell models:

    • H295R human adrenocortical cells - express endogenous SOAT1 and maintain steroidogenic capacity

    • Y1 mouse adrenocortical cells - useful for studies in a murine background

    • Primary adrenocortical cells - provide the most physiologically relevant system but have limited availability

  • Hepatic models:

    • HepG2 or Huh7 cells - useful for studying SOAT1 in the context of lipoprotein metabolism

    • Primary hepatocytes - more physiologically relevant but have shorter viability in culture

  • Macrophage models:

    • THP-1 cells (differentiated) - relevant for atherosclerosis research

    • Primary macrophages - more physiologically relevant but may have donor variability

  • Neuronal models:

    • SH-SY5Y - useful for studying SOAT1 in neuronal cholesterol metabolism

    • Primary neurons - more physiologically relevant but technically challenging

When designing experiments, researchers should consider species differences in SOAT1 regulation and function. Substantial interspecies differences exist in the mechanisms of cholesterol generation, as well as in the expression and activity of SOAT1 . These differences may affect the translation of findings between model systems.

For genetically modified models, CRISPR/Cas9-mediated gene editing offers advantages for creating precise modifications in endogenous SOAT1, while traditional overexpression or siRNA approaches provide flexibility for transient manipulation.

How can SOAT1 activity be measured quantitatively in biological samples?

Quantitative measurement of SOAT1 activity in biological samples requires careful consideration of methodological approaches:

  • Direct activity assays:

    • Microsomal fraction isolation from tissues or cells

    • Incubation with radiolabeled substrates ([14C]oleoyl-CoA or [3H]cholesterol)

    • Quantification of cholesteryl ester formation by thin-layer chromatography or HPLC

  • Cellular cholesterol esterification:

    • Loading cells with [3H]cholesterol followed by analysis of labeled cholesteryl esters

    • Fluorescent cholesterol analogs with subsequent lipid extraction and separation

    • Mass spectrometry-based quantification of cholesteryl ester species

  • Indirect measurements:

    • Quantification of cholesteryl ester content in lipid droplets using fluorescent dyes (e.g., Nile Red, BODIPY)

    • Measurement of free cholesterol/cholesteryl ester ratio using enzymatic assays

    • Imaging-based approaches to visualize and quantify lipid droplet formation

  • Standardization considerations:

    • Normalization to protein content or cell number

    • Inclusion of known SOAT1 inhibitors (e.g., CI-976) as negative controls

    • Comparison to reference samples with established SOAT1 activity

For tissue samples, careful preparation is essential to preserve enzymatic activity. Rapid processing, appropriate buffer conditions, and inclusion of protease inhibitors help maintain SOAT1 function during sample preparation.

What are the optimal conditions for expressing recombinant human SOAT1?

Optimizing expression conditions for recombinant human SOAT1 requires careful consideration of several factors:

  • Expression vectors:

    • Strong but controllable promoters (e.g., CMV for mammalian cells, polyhedrin for insect cells)

    • Inclusion of appropriate signal sequences for ER targeting

    • Consideration of codon optimization for the expression system

    • Strategic placement of affinity tags to minimize interference with transmembrane domains

  • Expression systems:

    • HEK293 or CHO cells - provide mammalian post-translational modifications

    • Sf9 or High Five insect cells - high expression levels for membrane proteins

    • Pichia pastoris - scalable but may require optimization for membrane proteins

  • Culture conditions:

    • Temperature modulation (often lower temperatures improve folding)

    • Addition of chemical chaperones (e.g., DMSO, glycerol) to enhance folding

    • Induction timing and duration optimization

    • Supplementation with cholesterol precursors or sterol regulatory element inhibitors

  • Verification strategies:

    • Western blotting with antibodies against SOAT1 or affinity tags

    • Enzymatic activity assays to confirm functional expression

    • Subcellular localization verification using microscopy or fractionation

When expressing SOAT1 for structural studies, considerations for protein stability and homogeneity become paramount. Addition of stabilizing ligands or inhibitors during expression and purification can help maintain a uniform conformation suitable for structural analysis .

What controls should be included when studying SOAT1 inhibitors?

Design of robust control experiments is essential when investigating SOAT1 inhibitors:

  • Positive controls:

    • Known SOAT1 inhibitors (e.g., CI-976, avasimibe, pactimibe)

    • Concentration-response curves for reference inhibitors

    • Verification of SOAT1 expression and basal activity

  • Negative controls:

    • Vehicle controls matching inhibitor solvent

    • Structurally similar but inactive compounds

    • SOAT1-deficient cells or tissues as background controls

  • Specificity controls:

    • Testing effects on related enzymes (e.g., SOAT2/ACAT2)

    • Assessment of general cytotoxicity independent of SOAT1 inhibition

    • Rescue experiments with SOAT1 overexpression

  • Validation approaches:

    • Multiple assay methods to confirm inhibition

    • Cellular and biochemical assays to distinguish direct vs. indirect effects

    • Time-course studies to differentiate immediate vs. delayed effects

When studying inhibitor binding to SOAT1, structural information can guide interpretation. Recent structural studies have shown that the inhibitor CI-976 binds inside the catalytic chamber of SOAT1 and blocks accessibility to critical active site residues (H460, N421, and W420) . This structural insight provides a framework for understanding the mechanism of inhibition and can guide rational design of new inhibitors.

How to interpret contradictory findings regarding SOAT1 activity in different experimental systems?

Contradictory findings regarding SOAT1 activity across different experimental systems are common and require careful analysis:

  • Systematic comparisons:

    • Standardize activity measurements using common reference compounds

    • Directly compare multiple cell types under identical conditions

    • Consider species differences in SOAT1 sequence, regulation, and activity

  • Contextual factors to consider:

    • Endogenous cholesterol levels in different systems

    • Expression of other cholesterol-metabolizing enzymes

    • Membrane composition differences affecting enzyme function

    • Post-translational modification variations between systems

  • Methodological considerations:

    • Substrate presentation methods (e.g., with cyclodextrin, in lipoproteins)

    • Assay conditions (pH, temperature, cofactors)

    • Detection methods and their sensitivity ranges

It's important to recognize that substantial interspecies differences exist in cholesterol metabolism mechanisms and SOAT1 activity . Recent research has demonstrated differences in antiatherogenic effects elicited by SOAT1 inhibitors between species , highlighting the importance of considering evolutionary context when translating findings between models.

Data analysis should employ descriptive statistics to characterize the distribution and variability of activity measurements, followed by appropriate inferential statistics to test hypotheses about differences between systems .

What statistical approaches are recommended for analyzing SOAT1 inhibition studies?

Statistical analysis of SOAT1 inhibition studies should be tailored to the experimental design and data characteristics:

  • Concentration-response analysis:

    • Non-linear regression to determine IC50 values

    • Four-parameter logistic models for classical sigmoid curves

    • Consideration of Hill slopes for mechanistic insights

    • Calculation of confidence intervals for potency comparisons

  • Time-course studies:

    • Repeated measures ANOVA or mixed-effects models

    • Area under the curve (AUC) calculations for cumulative effects

    • Kinetic modeling for mechanistic understanding

  • Sample size considerations:

    • Power analysis prior to experimentation

    • Adjustment for multiple comparisons when testing several inhibitors

    • Consideration of biological vs. technical replicates

  • Advanced techniques for complex datasets:

    • Principal component analysis for multidimensional data

    • Cluster analysis to identify patterns in inhibitor responses

    • Predictive modeling using machine learning approaches

These statistical approaches align with contemporary data analysis methodologies that emphasize systematic collection, cleaning, transformation, describing, modeling, and interpreting data . For inhibitor studies, predictive modeling can be particularly valuable in identifying structure-activity relationships and guiding rational inhibitor optimization.

How to normalize SOAT1 activity data across different tissue samples?

Appropriate normalization strategies are essential for comparing SOAT1 activity across diverse tissue samples:

  • Common normalization factors:

    • Total protein content (Bradford, BCA, or Lowry assays)

    • Cell number or DNA content

    • Housekeeping enzyme activities

    • SOAT1 protein expression levels (Western blot quantification)

  • Tissue-specific considerations:

    • Adrenal tissue: normalize to steroidogenic enzyme activities

    • Liver: consider hepatocyte content or liver-specific markers

    • Brain: region-specific normalization may be necessary

  • Internal standardization:

    • Include common reference samples across experiments

    • Develop tissue-specific activity standards

    • Express results as percentage of maximal activity

  • Statistical approaches for normalization:

    • Z-score normalization to account for different scales

    • Quantile normalization for non-parametric approaches

    • LOESS normalization for systematic bias correction

When comparing samples from different sources or processed at different times, batch effect correction may be necessary. This can be accomplished through statistical methods such as ComBat or through experimental design that includes batch bridging samples .

What is the evidence linking SOAT1 dysfunction to adrenal insufficiency?

The potential relationship between SOAT1 dysfunction and adrenal insufficiency is supported by several lines of evidence:

  • Animal model studies:

    • Naturally occurring mutations in the mouse Soat1 gene (as in ald, AKR, Soat1 ald mice) lead to lipid depletion in the adrenal cortex

    • Targeted disruption of Soat1 in mice results in variable abnormalities of cholesterol esterification and corticosterone synthesis

  • Mechanistic rationale:

    • SOAT1 is essential for maintaining readily-releasable cholesterol reserves needed for active steroidogenesis

    • Impaired SOAT1 activity could result in adrenal insufficiency through:
      a) Reduced cholesteryl ester reserves limiting substrate availability
      b) Toxic accumulation of free cholesterol damaging adrenal cells

  • Developmental expression:

    • SOAT1 is expressed in the developing human fetal adrenal cortex from 6-9 weeks postconception

    • This suggests a potential role in adrenal development and function establishment

  • Human genetic studies:

    • While mutational analysis of SOAT1 in a cohort of 43 patients with unexplained adrenal insufficiency failed to reveal significant coding sequence changes , this does not rule out:
      a) Regulatory region mutations affecting expression
      b) SOAT1 involvement in specific adrenal insufficiency subtypes
      c) SOAT1 contributions to milder forms of adrenal dysfunction

Interestingly, SOAT1 has been identified as a target of steroidogenic factor-1 (SF-1/NR5A1), a key regulator of adrenal development and steroidogenesis . This regulatory relationship further supports a functional role for SOAT1 in adrenal steroid production.

How does SOAT1 inhibition affect steroidogenesis in human adrenal cells?

SOAT1 inhibition has complex effects on steroidogenesis in human adrenal cells:

  • Acute effects on steroid production:

    • Decreased esterification leads to initial increase in free cholesterol availability

    • Potential short-term enhancement of steroidogenesis

    • Substrate depletion with sustained inhibition

  • Effects on cholesterol homeostasis:

    • Disruption of cholesteryl ester formation in lipid droplets

    • Alteration of free cholesterol/esterified cholesterol ratio

    • Potential accumulation of free cholesterol in cell membranes

  • Cellular stress responses:

    • Free cholesterol accumulation may trigger ER stress

    • Activation of the unfolded protein response

    • Potential cytotoxicity in steroidogenic cells with prolonged inhibition

  • Compensatory mechanisms:

    • Upregulation of cholesterol synthesis pathways

    • Altered expression of steroidogenic enzymes

    • Changes in hormone-sensitive lipase activity

These effects highlight the importance of SOAT1 in maintaining cholesterol reserves for steroidogenesis and protecting adrenal cells from the potentially damaging effects of free cholesterol . The balance between free and esterified cholesterol is critical for normal adrenal function, with SOAT1 playing a central role in this homeostatic regulation.

What are the implications of SOAT1 variants in disease pathogenesis?

SOAT1 genetic variants may contribute to disease through several mechanisms:

  • Potential involvement in adrenal disorders:

    • While not a common cause of adrenal dysfunction in a heterogeneous cohort studied, SOAT1 allelic variants may explain less severe cases of adrenal insufficiency

    • Variations could affect stress response capacity by limiting cholesteryl ester reserves

  • Associations with metabolic diseases:

    • SOAT1 has been linked to inflammation in multiple publications

    • Associations with fatty liver disease have been documented

    • Potential contributions to myocardial infarction pathogenesis

  • Implications in hepatic disorders:

    • Links to hepatocellular carcinoma and other liver neoplasms

    • Involvement in non-alcoholic fatty liver disease development

  • Cancer connections:

    • SOAT1 has been associated with neoplasms in published literature

    • Potential role in cholesterol metabolism alterations observed in cancer cells

The molecular mechanisms through which SOAT1 variants might contribute to these conditions include altered enzymatic activity, changes in protein stability or localization, and modified responses to regulatory factors. Studies comparing variant forms of SOAT1 should consider both basal activity and response to stimulatory or inhibitory signals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.