Recombinant Human Sterol regulatory element-binding protein 1 (SREBF1), partial

Shipped with Ice Packs
In Stock

Description

Research Applications

Mechanistic Studies

  • Investigating insulin-mediated lipogenesis through mTORC1 signaling pathways

  • Analyzing transcriptional repression via BHLHB2/BHLHB3 in muscle atrophy models

  • Cholesterol feedback regulation studies using truncated constructs

Diagnostic Development
Used as reference material in ELISA kits (e.g., detection range 7.8-500 pg/mL, sensitivity 1.95 pg/mL) :

Sample MatrixAverage Recovery (%)Range (%)
Serum9691-98
EDTA Plasma9792-100
Data from commercial ELISA validation

Key Experimental Findings

Regulation of Metabolic Pathways

  • Hepatic Function: Partial SREBF1 constructs retain capacity to activate ACACB (acetyl-CoA carboxylase 2), influencing mitochondrial fatty acid oxidation

  • Muscle Biology: Overexpression suppresses myogenic factors:

Gene AffectedFold Change (SREBP-1a)Biological Impact
MYOD1↓2.8×Impaired muscle differentiation
TNNT2↓3.1×Reduced contractile function
TTN↓4.2×Altered sarcomere assembly
Data derived from human myotube studies

Production Features

  • Expression system: Typically E. coli or HEK293 cells

  • Purity: >95% by SDS-PAGE

  • Stability: -80°C long-term storage recommended

Functional Validation

  • Luciferase reporter assays confirm SRE-dependent transcriptional activation

  • Electrophoretic mobility shift assays verify DNA binding capacity

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.
Please note: If you have any specific requirements regarding the glycerol content, kindly specify them in your order remarks.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.

Form
The delivery form is available in either liquid or lyophilized powder.
We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting the product. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-tagged
Synonyms
SREBF1; BHLHD1; SREBP1; Sterol regulatory element-binding protein 1; SREBP-1; Class D basic helix-loop-helix protein 1; bHLHd1; Sterol regulatory element-binding transcription factor 1
Datasheet & Coa
Please contact us to get it.
Expression Region
1-490aa
Mol. Weight
54.5kDa
Protein Length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Sterol regulatory element-binding protein 1 (SREBP1) is a precursor to the transcription factor form (processed sterol regulatory element-binding protein 1) and is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote the processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis.

SREBP1 is a key transcription factor that regulates the expression of genes involved in cholesterol biosynthesis and lipid homeostasis. It binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). SREBP1 exhibits dual sequence specificity, binding to both an E-box motif (5'-ATCACGTGA-3') and SRE-1 (5'-ATCACCCCAC-3').

SREBP1 regulates the promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway of sterol regulation.

SREBP1A is an isoform expressed only in select tissues, characterized by higher transcriptional activity compared to SREBP-1C. It can stimulate both lipogenic and cholesterogenic gene expression and plays a role in the nutritional regulation of fatty acids and triglycerides in lipogenic organs such as the liver.

SREBP-1C is the predominant isoform expressed in most tissues and exhibits weaker transcriptional activity compared to SREBP-1A. It primarily controls the expression of lipogenic genes and strongly activates global lipid synthesis in rapidly growing cells.

SREBP-1A and SREBP-1C lack the requirement for Golgi proteolytic processing, rendering them constitutively active in the transactivation of lipogenic gene promoters.
Gene References Into Functions
  1. Research indicates that the nBP1a/PKM2 interaction activates lipid metabolism genes in cancer cells. Furthermore, Thr-59 phosphorylation of SREBP-1a plays a crucial role in cancer cell proliferation. PMID: 29514980
  2. GTEE also downregulated the expression of AR and prostate-specific antigen (PSA) in both androgen-responsive and castration-resistant PCa cells. By blocking the SREBP-1/AR axis, GTEE suppressed cell growth and progressive behaviors, as well as activating the caspase-dependent apoptotic pathway in PCa cells. PMID: 30301150
  3. SREBP1 trans-activates CYP24A1 expression through SREBP binding elements present in the promoter. PMID: 29653103
  4. Berberine (BBR), an effective suppressor of SREBP1 and lipogenesis regulated through reactive oxygen species (ROS)/AMPK pathway, selectively inhibited the growth of G-R nonsmall cell lung cancer cells and rheumatoid arthritis patients but not that of normal cells. PMID: 28665143
  5. These findings suggest that SREBP-1c serves as a molecular bridge between lipid metabolism and cell cycle control in clear cell renal cell carcinoma tumorigenesis. PMID: 29138263
  6. Findings revealed that PTEN inhibits HBV replication as well as HBV HCV co-replication, with SREBP-1 involved in HBV HCV replication inhibition by PTEN. PMID: 29803738
  7. FTO increased the lipid accumulation in hepatocytes by increasing nuclear translocation of SREBP1c and SREBP1c maturation, thus improving the transcriptional activity of lipid droplet-associated protein CIDEC. PMID: 29486327
  8. Common SNPs (rs62064119, rs2297508, rs11868035, and rs13306741) in the SREBP-1c gene were selected and genotyped in 593 Han patients with NAFLD and 593 healthy controls. No significant differences in genotype and allele frequencies of these four SNPs were found between cases and controls, suggesting that these SNPs are not associated with the risk of NAFLD in the Chinese Han population. PMID: 27572914
  9. Data suggests that expression of CYP4F2 is down-regulated in the liver of mice with non-alcoholic fatty liver disease after high-fat/Western diet and in human hepatocyte cell line exposed to excess palmitic acid, oleic acid, or fructose. Two other genes are down-regulated, PPAR gamma and SREBP-1. (CYP4F2 = cytochrome P450 family 4 subfamily F member 2; PPAR = peroxisome proliferator-activated receptor). PMID: 28628909
  10. LncARSR promotes hepatic lipogenesis via the Akt/SREBP-1c pathway and contributes to the pathogenesis of nonalcoholic steatohepatitis. PMID: 29555473
  11. CpG sites located in the SREBF2 gene showed differential methylation in association with lipid traits. The expression of the SREBF1 gene was inversely associated with methylation of its corresponding CpGs. Genetic variants in SREBF1 were also associated with lipid profile. SREBF1 expression was directly associated with HDL cholesterol. PMID: 28173150
  12. Epidermal growth factor receptor (EGFR) signaling enhances miR-29 expression in glioblastoma cells via upregulation of Sterol regulatory element binding protein. PMID: 27477273
  13. Our finding reveals crucial roles for SREBP1 in lipid desaturation of ccRCC through regulation of NF-kappaB signaling, which provides not only new insights into the regulatory mode of NF-kappaB signaling but also a novel target for potential metabolic therapies. PMID: 29183723
  14. Our results suggest that relatively common genetic variants in stearoyl CoA desaturase and SREBF1 attenuated the positive associations between intake of a traditional diet rich in n-3 polyunsaturated fatty acids and increases in fasting cholesterol and HbA1c levels, as well as the waist-to-hip ratio among Yup'ik participants. PMID: 27467133
  15. Changes in distinct lipid ratios may converge on ARF1 to increase SBP-1/SREBP-1 activity. PMID: 27320911
  16. Variants in the TOM1L2/SREBF1 locus exert opposing effects of total-body lean mass (TB-LM) and total-body less head bone mineral density (TBLH-BMD). PMID: 28743860
  17. Data indicate that sterol regulatory element-binding proteins Srebp1 and Srebp2 are essential for the metabolic reprogramming of NK cells and for the attainment of elevated glycolysis and oxidative phosphorylation. PMID: 28920951
  18. Study identified a novel human specific lncRNA, lncHR1, as a negative regulator of SREBP-1c expression. Overexpression of lncHR1 inhibited expression of SREBP-1c and fatty acid synthase (FAS) and then repressed oleic acid-induced hepatic cell triglyceride (TG) and lipid droplet (LD) accumulation. PMID: 28367099
  19. Glucose adsorption to chitosan membranes increases proliferation of human chondrocytes via mammalian target of rapamycin complex 1 and sterol regulatory element-binding protein-1 signaling. PMID: 28218386
  20. miR-185 negatively regulates the differentiation of 3T3-L1 cells by targeting SREBP-1. PMID: 28701079
  21. The authors further demonstrated that the upregulation of sterol regulatory element-binding protein (SREBP)-1c by activation of the Akt and p70S6K pathways is critical for high-glucose-treated Porphyromonas gingivalis-induced NLRP3 expression. PMID: 28083517
  22. Results show that PPARalpha is downregulated and SREBP-1c is upregulated in steatosis L-02 cells. These changes increase lipid synthesis and reduce lipid disposal, which ultimately lead to hepatic steatosis. PMID: 27270405
  23. SREBP-1 and SREBP-2 mRNA expression levels were measured in EAT from 49 patients with CAD (26 with diabetes) and 23 controls without CAD or diabetes. SREBP expression was associated as a cardiovascular risk factor for the severity of CAD and the poor lipid control. PMID: 28367087
  24. The involvement of SREBP-1c in FASN promoter histone modification. PMID: 28027934
  25. The mitotic phosphorylation and stabilization of nuclear SREBP1 during cell division provide a link between lipid metabolism and cell proliferation. PMID: 27579997
  26. B7-H3 hijacks SREBP-1/FASN signaling mediating abnormal lipid metabolism in lung cancer. PMID: 27939887
  27. The genetic polymorphisms of SREBF1 could play a role in the mechanism for interindividual variation of atypical antipsychotics-induced metabolic syndrome (MetS). SCAP polymorphisms with drug-induced MetS were negative in this study. PMID: 26982812
  28. NS5ATP6 regulates the intracellular triglyceride level via FGF21, and independently of SIRT1 and SREBP1. PMID: 27179781
  29. Observations suggest that MALAT1 promotes hepatic steatosis and insulin resistance by increasing nuclear SREBP-1c protein stability. PMID: 26935028
  30. MiR-132 inhibited SIRT1 and SREBP-1c expression and downregulated their targeted genes, including HMGCR and FASN. PMID: 26898440
  31. Report demonstrated that overexpression of SULT2B1b-mediated angiogenic signaling was associated with tumor angiogenesis and poor clinical features of human gastric cancer. PMID: 26937945
  32. Data show that mutant p53 protein activates the sterol regulatory element-binding proteins SREBP-1 and SREBP-2-mediated signaling pathways in prostate cancer (PCa) cells. PMID: 26512780
  33. miR-33b is highly induced upon differentiation of human preadipocytes, along with SREBP-1, and miR-33b is an important regulator of adipogenesis. PMID: 26830228
  34. Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation. PMID: 26855332
  35. PRMT5-induced methylation prevented phosphorylation of SREBP1a on S430 by GSK3beta. PMID: 26759235
  36. mTORC2 positively regulates mSREBP1 stability and lipogenesis. Findings reveal a novel biological function of mTORC2 in the regulation of lipogenesis. PMID: 25893295
  37. The mTORC1/SREBP pathway is a major mechanism through which common oncogenic signaling events induce de novo lipid synthesis to promote aberrant growth and proliferation of cancer cells. PMID: 26028026
  38. hnRNP A1 is implicated in the free fatty acid-induced expression of SREBP-1a and of its target genes as well as in the lipid accumulation in hepatocytes. PMID: 26869449
  39. TG levels are regulated by HCBP6-sterol regulatory element binding protein 1c (SREBP1c)-mediated fatty acid synthase (FASN) expression. PMID: 25855506
  40. Aberrant activation of SREBP1c suppresses primary ciliogenesis by PLA2G3-mediated distortion of vesicular trafficking and suggests that PLA2G3 is a novel potential target to normalize ciliogenesis in SREBP1c-overexpressing cells, including cancer cells. PMID: 25904332
  41. PD-L1 induces epithelial-to-mesenchymal transition via activating SREBP-1c in renal cell carcinoma. PMID: 26141060
  42. Performed a detailed promoter/enhancer analysis of the ELOVL5 gene, and identified two new SREBP binding sites, one in the 10 kb upstream region and one in exon 1. PMID: 26321664
  43. Data indicate that glucose-mediated glycosylation promotes SREBP cleavage-activating protein (SCAP) trafficking to the Golgi Leading to sterol regulatory element binding protein 1 (SREBP-1) activation. PMID: 26555173
  44. Single nucleotide polymorphism (rs2297508) of SREBF-1 may serve as a genetic predisposition factor for the development of endometrial cancer. PMID: 24614076
  45. Report PCR techniques for genotyping SREBF1 rs8066560 variant in Iranian children/adolescents with metabolic syndrome. PMID: 26771965
  46. Data show that the cleavage site of the lipid-signaling protein sterol regulatory element binding transcription factor 1 (SREBP-1) intermediate bears rigid alpha-helical topology. PMID: 26392539
  47. We concluded that the 54(G/C) polymorphism of the SREBF-1 gene is associated with polycystic ovary syndrome (PCOS) and suggest that the SREBF-1 gene may play a role in genetic predisposition to PCOS. PMID: 25801724
  48. The results from this study demonstrate that metformin ameliorates PA-induced insulin resistance through the activation of AMPK and the suppression of SREBP-1c in skeletal muscle cells. PMID: 25891779
  49. Associations between triglyceride levels and SREBF1 and ABCG1 were also found in adipose tissue of the Multiple Tissue Human Expression Resource cohort. PMID: 25583993
  50. Gene expression analysis revealed that SREBP defines a gene signature that is associated with poor survival in glioblastoma. PMID: 25619842

Show More

Hide All

Database Links

HGNC: 11289

OMIM: 184756

KEGG: hsa:6720

STRING: 9606.ENSP00000348069

UniGene: Hs.592123

Protein Families
SREBP family
Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.; [Isoform SREBP-1aDelta]: Nucleus.; [Isoform SREBP-1cDelta]: Nucleus.
Tissue Specificity
Expressed in a wide variety of tissues, most abundant in liver and adrenal gland. In fetal tissues lung and liver shows highest expression.; [Isoform SREBP-1A]: Predominates in hepatoma cell lines. Also expressed in kidney, brain, white fat, and muscle.;

Q&A

What is the molecular structure and functional domains of human SREBP-1?

Human SREBP-1 is a membrane-bound transcription factor that exists in two isoforms: SREBP-1a and SREBP-1c, which are expressed from overlapping mRNAs from the same gene. The protein possesses two transmembrane regions connected by a short lumenal loop of approximately 30 hydrophilic amino acids, forming a hairpin domain that anchors it to the endoplasmic reticulum (ER) and nuclear envelope .

The N-terminal region (approximately 500 amino acids) contains the transcription factor domain that, upon proteolytic cleavage, translocates to the nucleus to activate gene expression. Specifically, the N-terminal region of SREBP-1a (1-198) has been successfully expressed and purified in recombinant form and shown to maintain its functional conformation . The two isoforms differ in their transcriptional activation potency, with SREBP-1a being a stronger activator than SREBP-1c.

How can researchers express and purify recombinant human SREBP-1?

Expression and purification of recombinant human SREBP-1 presents challenges due to its membrane-bound nature. Successful methodologies include:

  • Expression system selection: A baculovirus-insect cell expression system is more suitable than Escherichia coli for expressing recombinant proteins with high molecular weights like SREBP-1 .

  • Protein solubility enhancement: Adding a hexahistidine (6 × His)-maltose-binding protein (MBP) tag at the N-terminus and a FLAG tag at the C-terminus significantly improves solubility and enables affinity purification .

  • Domain-specific expression: Focus on expressing specific domains rather than the full-length protein. The cytosolic N-terminal (1-487) and C-terminal (569-1147) regions of SREBP-1a have been successfully expressed using the baculovirus system .

  • Purification strategy: For the N-terminal domain of SREBP-1a, the MBP tag should be retained after purification to maintain solubility, although this requires counter-screening during binding assays to eliminate false positives that bind to MBP rather than SREBP-1 .

  • Buffer optimization: For thermal shift assays and other biochemical analyses, an optimized buffer consisting of 50 mM MOPS, pH 7, 100 mM NaCl, 0.01% Triton X-100, and 1% DMSO has been established .

What experimental methods are effective for studying SREBP-1 promoter regulation?

The human SREBP-1a promoter has been mapped to a minimal region 75 bp upstream of the translation start site, containing three GC-boxes with overlapping binding sites for Sp1 and EGR-1 transcription factors . To study its regulation:

  • Promoter mapping: Use deletion constructs and reporter gene assays to identify minimal promoter regions responsible for SREBP-1a expression.

  • Transcription factor binding assays: Employ DNA-protein binding reactions at room temperature (20 minutes) using recombinant human SP1 protein or synthesized human EGR-1 protein .

  • Mutational analysis: Create site-directed mutations in the GC-boxes to evaluate their functional significance. Intact SP1-binding sites are essential for promoter activity, while EGR-1 has been shown to suppress transcription .

  • Tissue-specific analysis: Compare promoter activity across different cell types since SREBP-1a predominates in cultured cell lines, spleen, and intestine, while SREBP-1c is more prevalent in liver, muscle, and adipose tissue .

How can researchers design high-throughput screens to identify novel SREBP-1 binders or inhibitors?

Designing effective high-throughput screens for SREBP-1 binders requires careful methodology:

  • Thermal Shift Assay (TSA) optimization:

    • Use purified 6 × HisMBP-SREBP-1a (1-198) protein

    • Establish baseline thermal stability (Tm value)

    • Optimize buffer conditions (50 mM MOPS, pH 7, 100 mM NaCl, 0.01% Triton X-100)

    • Verify DMSO tolerance (up to 1% concentration)

    • Ensure protein stability at room temperature for at least 6 hours

  • Counter-screening strategy:

    • Perform parallel screening with purified 6 × HisMBP-FLAG (without SREBP-1a) to exclude compounds that bind to the tag rather than the target

    • Consider compounds with ΔTm > 0.40 °C (3 × SD) in the counter assay as false hits

  • Secondary validation using Surface Plasmon Resonance (SPR):

    • Immobilize purified 6 × HisMBP-SREBP-1a (1-198) on a CM5 sensor chip using amine-coupling

    • Pre-concentrate protein at pH 4.4 (below its isoelectric point of 4.5-4.6)

    • Validate active conformation by confirming maltose binding (expected KD ~1.33 μM)

    • Test compounds at multiple concentrations (e.g., 10 and 40 μM, then 3.125 to 50 μM dose series)

    • Calculate binding responses and exclude non-specific binders with Rmax values exceeding three times the calculated theoretical value

What are the critical considerations for assessing SREBP-1 inhibitor specificity and structure-activity relationships?

When developing SREBP-1 inhibitors, researchers should consider:

How can researchers accurately interpret contradictory results in SREBP-1 functional studies?

Contradictions in SREBP-1 research can arise from several factors:

  • Isoform-specific effects: SREBP-1a and SREBP-1c have different activation potencies and tissue expression patterns. Ensure experiments specify which isoform is being studied.

  • Compensatory mechanisms: SREBP-1-deficient mice exhibit compensatory activation of SREBP-2, potentially masking phenotypes. Consider dual inhibition approaches or use tissue-specific conditional knockouts to minimize compensation .

  • Experimental system variations: Results from cell lines versus primary cells or animal models may differ due to variations in SREBP-1 processing machinery. Validate findings across multiple systems.

  • Protein tag interference: The use of tags like MBP for solubility enhancement can affect protein function or lead to false positives in binding assays. Always include appropriate controls with tagged proteins lacking SREBP-1 .

  • Metabolic context: SREBP-1 regulation is highly dependent on nutritional status and metabolic conditions. Standardize feeding/fasting status in animal studies and media conditions in cell culture.

What methodological approaches can overcome challenges in studying SREBP-1 proteolytic regulation?

SREBP-1 is regulated by proteolytic cleavage that releases the active N-terminal domain in response to sterol depletion . Research approaches include:

  • Mutational analysis: Create mutations in the region of the first transmembrane domain where proteolytic cleavage occurs to identify critical residues.

  • Protease inhibitor screening: Systematically test protease inhibitors to identify enzymes involved in SREBP-1 processing.

  • Cellular sterol manipulation: Use sterol depletion (through statin treatment or lipoprotein-deficient serum) or sterol loading (cholesterol or oxysterols) to modulate SREBP-1 cleavage in experimental models.

  • Visualization techniques: Employ fluorescently tagged SREBP-1 constructs to monitor subcellular localization and processing in real-time using confocal microscopy.

  • Co-immunoprecipitation: Identify protein-protein interactions with SREBP cleavage-activating protein (SCAP) and insulin-induced gene proteins (INSIGs), which form complexes with SREBP-1 and regulate its activation .

What are the properties of validated SREBP-1 binding compounds?

Recent research has identified two novel compounds that bind directly to SREBP-1. Their properties are summarized in the table below:

ParameterCompound 1Compound 2
StructureProprietary structure (See reference)Proprietary structure (See reference)
Rmax (RU)14.825.6
KD (μM)20.193.9
Known ActivitiesNo previous reportsT-Type Calcium Channel inhibitor (EC50: 5.15 μM)
Binding CharacteristicsShows dose-dependent bindingRequires higher concentrations for saturation (up to 200 μM)
Target SpecificitySpecific to SREBP-1aSpecific to SREBP-1a

Table 1: Properties of confirmed SREBP-1 binding compounds identified through high-throughput screening and validated by surface plasmon resonance .

How does the expression pattern of SREBP-1 isoforms vary across tissues?

Understanding the tissue-specific expression patterns of SREBP-1 isoforms is crucial for experimental design and interpretation:

Tissue/Cell TypePredominant SREBP-1 IsoformResearch Implications
Cultured cell linesSREBP-1aMost in vitro studies reflect SREBP-1a function
SpleenSREBP-1aConsider for immunological studies of lipid metabolism
IntestineSREBP-1aRelevant for nutrient absorption research
LiverSREBP-1cCritical for hepatic lipogenesis studies
MuscleSREBP-1cImportant for studies on insulin sensitivity
Adipose tissueSREBP-1cKey for adipogenesis and fat storage research

Table 2: Tissue distribution of SREBP-1 isoforms and research implications. Compiled from references .

What experimental conditions optimize recombinant human SREBP-1 stability?

Establishing optimal conditions for maintaining recombinant SREBP-1 stability is essential for reliable experimental results:

ParameterOptimized ConditionEffect on Protein Stability
Buffer50 mM MOPS, pH 7Maintains optimal pH for stability
Salt concentration100 mM NaClProvides ionic strength without precipitation
Detergent0.01% Triton X-100Prevents aggregation
DMSO toleranceUp to 1%Compatible with compound screening
Temperature stabilityRoom temperature for up to 6 hoursTm and ΔTm values remained consistent
StorageFlash-frozen in liquid nitrogen, stored at -80°CPreserves activity for long-term use
Protein tagRetain MBP tag after purificationCritical for maintaining solubility

Table 3: Optimized conditions for recombinant human SREBP-1 stability in experimental applications. Data compiled from reference .

What emerging approaches might advance SREBP-1 research beyond current limitations?

Current limitations in SREBP-1 research include the lack of specific inhibitors and incomplete understanding of its three-dimensional structure. Future research directions include:

  • Structural biology approaches: Efforts to solve the crystal structure of human SREBP-1 would facilitate structure-based drug design and deeper understanding of its molecular mechanism.

  • Protein knockdown technology: As an alternative to direct inhibition, targeted protein degradation approaches could be employed to regulate SREBP-1 levels through the ubiquitin-proteasome pathway .

  • Comparative analysis with SREBP-2: Purifying the N-terminal region of human SREBP-2 could contribute to understanding structural differences between SREBP-1 and SREBP-2, aiding the development of isoform-selective modulators .

  • Therapeutic validation: Development of SREBP-1-specific inhibitors would enable examination of the proof-of-concept of SREBP-1 as a therapeutic target for obesity and resultant atherosclerotic diseases .

  • Integration with systems biology: Combining SREBP-1 research with broader omics approaches could provide insights into its role within complex metabolic networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.