Recombinant Human Sterol regulatory element-binding protein 2 (SREBF2), partial

Shipped with Ice Packs
In Stock

Description

Role in Lipid Metabolism

  • Cholesterol Synthesis: Directly activates HMGCR (HMG-CoA reductase) and SQLE (squalene epoxidase) .

  • Fatty Acid Biosynthesis: Cooperates with SREBF1 to upregulate fatty acid synthase genes .

  • Metabolic Checkpoint in T Cells: SREBF2 is essential for CD8+ T-cell blastogenesis during viral infection, ensuring cholesterol availability for membrane synthesis .

Regulatory Mechanisms

MechanismDescriptionSources
Sterol SensingSCAP/SREBF2 complex detects low sterol levels, triggering proteolytic cleavage
Nuclear ImportImportin β mediates nuclear translocation; Ran-GTP dissociates SREBF2-importin β complex
mTOR DependencymTOR signaling links T-cell activation to SREBF2 enrichment at lipid gene promoters

Experimental Models

  • Knockdown Studies: Silencing SREBF2 inhibits cholesterol biosynthesis and T-cell proliferation .

  • ELISA Quantification: Kits (e.g., HUEB1268) measure SREBF2 levels in serum/plasma (0.312–20 ng/mL) .

Disease Relevance

SREBF2 dysregulation is implicated in:

  • Hypercholesterolemia: Mutations in SREBF2 disrupt cholesterol homeostasis .

  • Cancer Metabolism: SREBF2 fuels lipid synthesis in rapidly dividing cells .

Applications in Research and Diagnostics

  • Transcriptional Assays: Recombinant SREBF2 is used to study promoter binding and gene activation.

  • Biomarker Development: ELISA kits enable quantification of SREBF2 in metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SREBF2; BHLHD2; SREBP2; Sterol regulatory element-binding protein 2; SREBP-2; Class D basic helix-loop-helix protein 2; bHLHd2; Sterol regulatory element-binding transcription factor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-484
Protein Length
Processed sterol regulatory element-binding protein 2 chain
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS RILL
Uniprot No.

Target Background

Function
Sterol regulatory element-binding protein 2 (SREBF2) is a precursor to the transcription factor form. Membrane-bound within the endoplasmic reticulum, it is processed upon low sterol concentrations. This releases the transcription factor, which translocates to the nucleus and activates genes involved in cholesterol biosynthesis. SREBF2 is a key regulator of cholesterol biosynthesis gene expression, binding to sterol regulatory element 1 (SRE-1; 5'-ATCACCCCAC-3') and exhibiting dual sequence specificity for both E-box (5'-ATCACGTGA-3') and SRE-1 motifs. It regulates transcription of genes within the cholesterol synthesis pathway.
Gene References Into Functions
  1. SREBF2 polymorphism rs2269657 demonstrates significant associations with Alzheimer's disease (LOAD) biomarkers and gene expression levels. Furthermore, SREBF2 expression in LOAD frontal cortices inversely correlated with age at death, suggesting potential influence on survival. PMID: 29503034
  2. SREBP-2 regulates autophagy-related gene expression in human liver cells. PMID: 29336468
  3. High SREBP-2 expression is associated with hypercholesterolemia. PMID: 29678744
  4. Lysosomal membrane trafficking alters cholesterol distribution, regulating SREBP-2. PMID: 28696297
  5. SREBP2 gene polymorphisms are significantly associated with osteonecrosis of the femoral head and lipid metabolism disorders. PMID: 28901487
  6. The rs2267439C/T polymorphism in SREBF-2 increases type 2 diabetes susceptibility in an Iranian population. PMID: 29601949
  7. Hexacosanol activates AMPK and hepatic autophagy, inhibiting SREBP2, leading to hypocholesterolemia and improved hepatic steatosis. PMID: 28676202
  8. CpG sites in SREBF2 exhibit differential methylation associated with total cholesterol levels; SREBF2 expression inversely correlates with methylation. PMID: 28173150
  9. Acidic pH-responsive SREBP2 target genes are linked to reduced cancer patient survival. PMID: 28249167
  10. SREBP-2 plays a novel role in inducing a stem cell-like phenotype and prostate cancer metastasis. PMID: 26883200
  11. SREBF-2 may be involved in white matter tract integrity in bipolar disorder, potentially influencing CNS myelination. PMID: 27771555
  12. High SREBF2 expression correlates with increased carotid intima-media thickness. PMID: 27841945
  13. Epithelial cholesterol deficiency offers protection against inflammation via the SREBP2-HuR circuit, despite triggering transient pro-inflammatory signals. PMID: 27703009
  14. Dietary flavones counteract phorbol 12-myristate 13-acetate-induced SREBP-2 processing in hepatic cells. PMID: 27778136
  15. Ligand-activated p75NTR triggers a hepatocyte signaling pathway involving p38 MAPK and caspase-3, mediating SREBP2 activation and regulating LDLRs and lipid uptake, particularly after injury or inflammation. PMID: 26984409
  16. EGFR and ERBB4 signaling interacts with SREBP-2-regulated cholesterol metabolism, potentially impacting ERBB-regulated development and metabolic remodeling in ERBB-driven cancers. PMID: 26535009
  17. SREBP2 knockdown lowers ACSL1 mRNA and protein levels in HepG2 cells. PMID: 26728456
  18. Lysophosphatidylcholine (LPC) upregulates SREBP-2 and cholesterol efflux in vascular endothelium; 25-hydroxycholesterol (25-HC) inhibits these effects; both upregulate interleukin-6 and interleukin-8 release. PMID: 25998247
  19. Luteolin modulates HMGCR transcription by decreasing SREBP-2 expression and nuclear translocation. PMID: 26302339
  20. HCV core protein disrupts cholesterol homeostasis via the SREBP2 pathway; miR-185-5p is involved in core protein regulation of SREBP2. PMID: 25914460
  21. AMPK activation inhibits SREBP-2, HMGCR, and HMGCS expression, suppressing TSH-stimulated SREBP-2 upregulation in HepG2 cells. PMID: 25933205
  22. SREBP-2 plays a significant role in lipid and glucose metabolism regulation in hypertensive rats. PMID: 24908080
  23. Leptin weakly stimulates LDLR expression via JAK-STAT signaling but primarily inhibits it by suppressing SREBP2. PMID: 25488447
  24. SREBF2 gene polymorphisms are associated with metabolic syndrome in clozapine-treated patients. PMID: 25201120
  25. SREBP-2 rs2228314 G to C change and variant C genotype, along with LXRalpha rs11039155 G to A change and variant A, may contribute to polycystic ovary syndrome (PCOS) in the Chinese Han population. PMID: 25005769
  26. SREBP-induced NLRP3 inflammasome contributes to atherosclerosis. PMID: 25188917
  27. The rs2228314 G>C polymorphism in SREBP-2 may increase non-alcoholic fatty liver disease (NAFLD) risk. PMID: 24992162
  28. SREBP2-miR-92a-inflammasome exacerbates endothelial dysfunction during oxidative stress. PMID: 25550450
  29. SREBP-2 rs2228314 G to C change and variant C genotype may increase knee osteoarthritis risk in the Chinese Han population. PMID: 24496149
  30. FoxO4 interacts with SREBP2 and HIF2alpha to modulate CYP51 promoter activity. PMID: 24353279
  31. No association found between SREBF-2 1784G>C or SCAP 2386A>G SNPs and ischemic heart disease in patients with obstructive sleep apnea. PMID: 24868893
  32. A SNP tagging XRCC6 and SREBF2 modifies the bladder cancer risk-smoking association. PMID: 24382701
  33. SREBP cleavage regulates Golgi-to-endoplasmic reticulum recycling of SCAP. PMID: 24478315
  34. SREBP-2 negatively regulates FXR-mediated transcriptional activation of the FGF19 gene in human intestinal cells. PMID: 24321096
  35. SREBP-2 gene polymorphisms and their interaction with IGFBP-3 are associated with increased ANFH risk in the Chinese population. PMID: 23158139
  36. Atheroprone flow induces NLRP3 inflammasome in endothelium through SREBP2 activation. PMID: 23838163
  37. SREBP-2 and Scap are regulated by factors driving prostate growth, suggesting a potential role in prostate carcinogenesis. PMID: 23454642
  38. Starvation regulates endothelial lipase expression via SREBP-2. PMID: 23102786
  39. SREBP2 inhibition ameliorates inflammatory cytokine-induced cholesterol accumulation in HepG2 cells. PMID: 23044239
  40. SREBP-2 is associated with osteoarthritis pathogenesis. PMID: 22662110
  41. Endoplasmic reticulum stress-induced SREBP-2 activation contributes to renal proximal tubule cell injury by dysregulating lipid homeostasis. PMID: 22573382
  42. SREBP-2 is a direct target of amyloid-beta protein in cholesterol homeostasis impairment. PMID: 22573671
  43. SREBP-2 1784 G/C polymorphism is associated with non-alcoholic fatty liver disease in Asian Indians. PMID: 22182810
  44. Linalool reduces 3-hydroxy-3-methylglutaryl CoA reductase expression via SREBP-2 and ubiquitin-dependent mechanisms. PMID: 21944868
  45. Oral contraceptives maintain high LDLR expression by stimulating its transcription factor SREBP2 in placental trophoblasts. PMID: 21757058
  46. No association found between SREBF-2 1784G>C or SCAP 2386A>G SNPs and premature coronary artery disease or lesion extent in a Chinese population. PMID: 20111910
  47. HIV-1 transcription in T cells is linked to cholesterol homeostasis through SREBP2 control of TFII-I expression. PMID: 21613400
  48. Hepatic NPC1L1 in Chinese female gallstone patients may be mediated by SREBP2. PMID: 20144195
  49. miR-33, encoded within SREBP2, inhibits cholesterol export and fatty acid oxidation. PMID: 20732877
  50. miR-33 and SREBP-2 mRNAs are coexpressed. PMID: 20566875
Database Links

HGNC: 11290

OMIM: 600481

KEGG: hsa:6721

STRING: 9606.ENSP00000354476

UniGene: Hs.443258

Protein Families
SREBP family
Subcellular Location
[Sterol regulatory element-binding protein 2]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 2]: Nucleus.
Tissue Specificity
Ubiquitously expressed in adult and fetal tissues.

Q&A

What is the molecular structure of SREBF2 and how does it relate to its cellular function?

SREBF2 is produced as a large precursor molecule attached to the endoplasmic reticulum (ER) membrane. The protein contains a basic helix-loop-helix leucine zipper (bHLH-Zip) domain that is critical for its function as a transcription factor. SREBF2 is tethered to the ER and nuclear envelope by a hairpin domain consisting of two transmembrane regions connected by a short lumenal loop of approximately 30 hydrophilic amino acids .

The protein has a distinctive architectural arrangement with functional domains distributed across different cellular compartments. The N-terminal segment contains the bHLH-Zip domain responsible for DNA binding and transcriptional activation, while the C-terminal regulatory domain plays a critical role in responding to cellular sterol levels. This structural organization enables SREBF2 to serve as a direct sensor of cellular cholesterol status and control cholesterol homeostasis by stimulating transcription of sterol-regulated genes .

How should researchers approach experimental designs to study SREBF2 activation mechanisms?

When designing experiments to study SREBF2 activation:

  • Establish baseline conditions by determining endogenous SREBF2 expression in your cell model through RT-qPCR and western blotting

  • Create sterol-depleted and sterol-overloaded conditions using:

    • Statin treatment (e.g., lovastatin) at 1-5 μM for depletion

    • Cholesterol supplementation (10-50 μg/ml) for overloading

  • Monitor both precursor and mature forms of SREBF2 using antibodies specific to different domains

  • Include time-course experiments to capture the dynamic nature of SREBF2 processing

  • Validate functional activation by measuring downstream targets such as LDL receptor and cholesterol synthesis enzymes

The key dependent variables should include both SREBF2 cleavage (ratio of mature to precursor forms) and transcriptional activity of target genes . Control for confounding variables such as cell density, passage number, and expression levels of SREBF2 regulatory proteins like SCAP and Insig1.

What are the critical sequences required for proper proteolytic activation of recombinant SREBF2?

Proteolytic processing of SREBF2 requires specific structural elements on both sides of the ER membrane:

RegionCritical SequenceFunctionConservation
Lumenal loopArginine residueEssential for first cleavage site recognitionConserved in human and hamster SREBP-1 and SREBP-2
Cytosolic faceDRSR tetrapeptideRequired for maximal cleavage efficiencyConserved across species
C-terminal regionResidues 1034 to C-terminusMediates sterol-regulated suppression of cleavageSubject to alternative splicing

Researchers should ensure that recombinant constructs include these critical regions. In sterol-depleted cells, a protease cleaves the protein in the region of the first transmembrane domain, releasing an NH2-terminal fragment of approximately 500 amino acids that activates transcription of genes encoding the low density lipoprotein receptor and enzymes of cholesterol synthesis. Conversely, in sterol-overloaded cells, proteolysis does not occur, and transcription is repressed .

When designing SREBF2 constructs, consider that alternative splicing affects the C-terminal region: the form encoded by the "a" class exons (exons 18a and 19a) undergoes sterol-regulated cleavage, while the form encoded by the "c" class exons (18c and 19c) is cleaved less efficiently and is not suppressed by sterols .

How does recombinant SREBF2 translocate to the nucleus and what methods can measure this process?

The nuclear import of mature SREBF2 follows a distinct transport pathway mediated by importin β without requiring importin α. This process is directly dependent on the Ran-GTP/GDP cycle:

  • The mature form of SREBF2 binds directly to importin β in the absence of importin α

  • Ran-GTP (but not Ran-GDP) causes dissociation of the SREBF2-importin β complex

  • G19VRan-GTP inhibits the nuclear import of SREBF2 in living cells

  • The helix-loop-helix-leucine zipper motif of SREBF2 contains a novel type of nuclear localization signal that binds directly to importin β

To effectively measure nuclear translocation, researchers can employ:

  • Fluorescence microscopy with GFP-tagged SREBF2 constructs to track real-time movement

  • Nuclear/cytoplasmic fractionation followed by western blotting

  • Chromatin immunoprecipitation (ChIP) to assess DNA binding at target gene promoters

  • In vitro nuclear import assays using permeabilized cell systems with recombinant importin β, Ran, and p10/NTF2

For quantitative analysis, measure the nuclear:cytoplasmic ratio of SREBF2 signal across different time points after sterol depletion or other stimuli. This provides a dynamic view of the import process rather than static endpoints.

What expression systems yield optimal functional recombinant SREBF2 for in vitro studies?

Based on the literature, several expression systems can be employed for producing recombinant SREBF2, each with distinct advantages:

Expression SystemConstruct DesignPurification TagYieldFunctionality
E. coliFL-SREBP2 in pGEX-6P-3GST-tagModerateGood for binding studies
E. coliSREBP2(1-481) in pRSETAHis-tagHighActive form for DNA binding
E. coliGFP-SREBP2 in pRSETA-GFP*His-tag + GFPModerateUseful for visualization
MammalianTK promoter with epitope tagVariousLowPhysiological regulation

For functional studies, low-level expression systems often yield more physiologically relevant results. The literature indicates that using a vector that achieves low-level expression of epitope-tagged SREBPs under control of the relatively weak thymidine kinase promoter from herpes simplex virus provides better results than high-expression systems. SREBPs produced at low levels were subject to the same regulated cleavage pattern as the endogenous SREBPs, whereas overproduced SREBPs showed aberrant processing .

When expressing the N-terminal active domain (amino acids 1-481), researchers should consider including a FLAG tag with BglII and BamHI sites for easy detection and purification .

What approaches can identify and validate novel SREBF2 protein-protein interactions?

To identify and characterize SREBF2 interactions with other proteins:

  • Identification Methods:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid screening with the N-terminal domain as bait

    • Proximity labeling techniques (BioID or APEX) to capture transient interactions

    • Co-immunoprecipitation followed by western blotting for candidate interactors

  • Validation Approaches:

    • Reciprocal co-immunoprecipitation studies

    • FRET or BRET assays to demonstrate direct interactions in living cells

    • In vitro binding assays with purified recombinant proteins

    • Mammalian two-hybrid assays to map interaction domains

  • Functional Assessment:

    • siRNA knockdown of interaction partners to assess effects on SREBF2 processing

    • CRISPR-Cas9 editing to modify interaction interfaces

    • Reporter gene assays to measure transcriptional consequences of interactions

Known SREBF2 interactions include INSIG1 and the CREB-binding protein . When designing interaction studies, consider the structural context—interactions may differ between the precursor form at the ER membrane and the mature nuclear form. The direct binding of SREBF2 to importin β represents a novel interaction mechanism distinct from classical nuclear import pathways .

How can researchers accurately measure SREBF2 transcriptional activity in experimental models?

To measure SREBF2 transcriptional activity:

  • Reporter Gene Assays:

    • Construct luciferase reporters containing sterol regulatory elements (SREs)

    • Include both wild-type and mutated SRE sequences as controls

    • Co-transfect with expression vectors for mature SREBF2 or empty vector

    • Normalize to a constitutive reporter (e.g., Renilla luciferase)

  • Endogenous Target Gene Expression:

    • Measure mRNA levels of SREBF2 target genes (LDLR, HMGCR, PCSK9) by RT-qPCR

    • Validate at the protein level through western blotting

    • Perform time-course experiments to capture the kinetics of activation

  • Genome-Wide Approaches:

    • ChIP-seq to map genome-wide binding sites of SREBF2

    • RNA-seq to identify all genes regulated by SREBF2 activation/inhibition

    • CUT&RUN or CUT&Tag as alternative approaches with higher sensitivity

  • Control Considerations:

    • Include sterol-depleted and sterol-loaded conditions

    • Compare wild-type SREBF2 with DNA-binding domain mutants

    • Use SREBF2 knockout or knockdown models as negative controls

For accurate interpretation, it's crucial to confirm the nuclear translocation of SREBF2 concurrent with transcriptional activity measurements. The dual transmembrane topology of SREBF2 necessitates careful experimental design to distinguish between regulated release of the active domain and constitutive transcriptional activity .

What methodologies can evaluate the impact of mutations in different SREBF2 domains?

To systematically assess the functional consequences of SREBF2 mutations:

  • Structure-Based Mutation Design:

    • Target conserved residues in the bHLH-Zip domain for DNA binding studies

    • Modify the DRSR tetrapeptide sequence on the cytosolic face to assess cleavage efficiency

    • Alter the arginine in the lumenal loop essential for proteolysis

    • Create chimeric constructs to map domain-specific functions

  • Expression Systems:

    • Use the thymidine kinase promoter for physiological expression levels

    • Employ epitope-tagged constructs for tracking different protein forms

    • Create GFP fusion proteins for live-cell imaging of mutant localization

  • Functional Readouts:

    • Proteolytic processing efficiency (precursor:mature ratio)

    • Nuclear import rates using fluorescence recovery after photobleaching

    • DNA binding affinity using electrophoretic mobility shift assays

    • Transcriptional activity with reporter gene assays

  • Advanced Approaches:

    • CRISPR-Cas9 knock-in of mutations to assess effects at endogenous expression levels

    • Correlate in vitro findings with identified human polymorphisms

    • Use molecular dynamics simulations to predict structural impacts of mutations

When designing mutation studies, ensure that expression constructs incorporate all domains necessary for proper regulation. For example, when studying the sterol-mediated suppression of SREBF2 cleavage, include the extreme C-terminal region (residue 1034 to the C-terminus), as this region is critical for sterol responsiveness .

What experimental approaches can differentiate between the specific functions of SREBF1 and SREBF2?

Despite structural similarities, SREBF1 and SREBF2 have distinct regulatory roles. To differentiate their functions:

  • Selective Manipulation Strategies:

    • Use isoform-specific siRNAs or CRISPR-Cas9 targeting

    • Employ selective small molecule inhibitors where available

    • Create cell lines with conditional expression of each factor

    • Design rescue experiments with one isoform in knockout backgrounds

  • Target Gene Profiling:

    • Perform ChIP-seq with antibodies specific to each isoform

    • Compare RNA-seq profiles after selective knockdown

    • Focus on genes preferentially regulated by each factor (cholesterol synthesis genes for SREBF2; fatty acid synthesis genes for SREBF1)

  • Regulatory Response Analysis:

    • Test differential responses to sterol depletion versus fatty acid availability

    • Examine temporal dynamics of activation under various stimuli

    • Assess post-translational modifications specific to each isoform

  • Interaction Partner Comparison:

    • Perform comparative interactome analysis

    • Identify cofactors that preferentially bind one isoform

    • Map differential protein complexes formed around each factor

For rigorous comparative studies, researchers should validate antibody specificity through knockout controls and consider using epitope-tagged versions of each protein to ensure accurate detection. The processing of SREBF1 and SREBF2 occurs through similar mechanisms, but with distinct regulatory inputs and kinetics that should be accounted for in experimental design .

What methods can detect and characterize post-translational modifications of recombinant SREBF2?

Post-translational modifications (PTMs) significantly impact SREBF2 function. To study these modifications:

  • Identification Approaches:

    • Mass spectrometry-based proteomics on purified recombinant SREBF2

    • Phospho-specific antibodies for western blotting

    • Metabolic labeling with 32P-orthophosphate for phosphorylation studies

    • Ubiquitination analysis using His-tagged ubiquitin pulldowns

  • Site-Specific Mutagenesis:

    • Generate alanine substitutions at predicted modification sites

    • Create phosphomimetic mutations (S/T to D/E) to simulate constitutive phosphorylation

    • Develop non-modifiable lysine mutants to prevent ubiquitination

    • Employ CRISPR-Cas9 to modify endogenous modification sites

  • Functional Consequences:

    • Assess effects on protein stability using cycloheximide chase assays

    • Determine impact on nuclear translocation with immunofluorescence

    • Measure DNA binding affinity changes with EMSAs

    • Quantify transcriptional activity alterations with reporter assays

  • Modification Dynamics:

    • Perform time-course analyses after stimulation

    • Use phosphatase inhibitors to preserve phosphorylation states

    • Apply proteasome inhibitors to capture ubiquitinated intermediates

    • Employ proximity labeling to identify modifying enzymes

When working with recombinant SREBF2, researchers should consider that bacterial expression systems lack mammalian PTM machinery. For studies requiring physiological modifications, insect or mammalian expression systems may be more appropriate despite potentially lower yields .

How can recombinant SREBF2 be utilized to investigate metabolic disease mechanisms?

Recombinant SREBF2 provides valuable tools for studying metabolic disorders:

  • Disease-Associated Variant Analysis:

    • Express SNP variants identified in genome-wide association studies

    • Compare wild-type and variant SREBF2 for functional differences

    • Assess the impact on cholesterol homeostasis in relevant cell types

    • Correlate biochemical findings with clinical phenotypes

  • Therapeutic Target Validation:

    • Screen for compounds that modulate SREBF2 processing

    • Develop high-throughput assays using reporter systems

    • Validate hit compounds in disease-relevant cell models

    • Test combination effects with established cholesterol-lowering drugs

  • Tissue-Specific Effects:

    • Compare SREBF2 function in hepatocytes, adipocytes, and other metabolic tissues

    • Investigate tissue-specific cofactors using pulldown assays

    • Analyze differential regulation in normal versus diseased tissue samples

    • Develop tissue-specific SREBF2 modulators

  • Clinical Correlation Studies:

    • Correlate SREBF2 activity biomarkers with disease progression

    • Analyze SREBF2 binding to SREs in patient-derived samples

    • Use recombinant proteins as standards for quantitative assays

    • Develop diagnostic tools based on SREBF2 activity signatures

For investigating conditions like familial hypercholesterolemia or metabolic syndrome, researchers should consider that certain SREBF2 variants have been associated with increased risk of knee osteoarthritis, suggesting broader implications beyond cholesterol metabolism . Human-derived cell models with appropriate genetic backgrounds will provide more translatable results than generic cell lines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.