Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1) is a protein that, based on structural and functional studies, is involved in promoting neuronal cell survival under stress conditions . SDIM1, is also known to interact with DNAJB4, a heat shock protein homolog, and is downregulated in Alzheimer's Disease (AD) brains . The SDIM1 gene encodes a 146 amino acid protein that includes a signal peptide and two transmembrane domains .

Gene and Protein Structure

The SDIM1 gene encodes a protein with a typical N-terminal signal peptide of 26 amino acids and two primary transmembrane helices. The molecular weight of the protein is approximately 13 kDa . SDIM1 protein sequence contains two potential phosphorylation sites and two O-linked glycosylation sites, but no N-linked glycosylation site .

Expression and Distribution

SDIM1 is expressed in various human and mouse tissues, with higher levels observed in the brain, muscle, heart, and reproductive organs . In the brain, the dimeric form of SDIM1 is dominant, while the monomer is almost undetectable . SDIM1 is more abundant in neurons than in astrocytes and is present throughout the cytoplasm and neural processes, but not in the nuclei .

Role in Neuroprotection

SDIM1 promotes neuronal cell survival under stress conditions . Overexpression of SDIM1 in neuro-progenitor cells improves their ability to survive after injurious insults, while its downregulation accelerates cell death induced by oxygen-glucose deprivation (OGD) . SDIM1 interacts with DNAJB4, a heat shock protein that enhances apoptosis . SDIM1 co-overexpression can attenuate cell death caused by DNAJB4, suggesting that SDIM1 may sequester DNAJB4, thus increasing cell viability .

Response to Stress Conditions

SDIM1 is highly responsive to stress conditions that mimic insults causing neurodegeneration in AD brains . SDIM1 mRNA is significantly downregulated after OGD treatment, but becomes significantly upregulated 16 hours after recovery .

Dimerization

SDIM1 can form both homo- and hetero-dimers . Co-immunoprecipitation experiments have demonstrated that SDIM1 forms dimers and also forms hetero-dimers with SDIM1-EGFP . The dimeric structures are found on the membrane and can be detected by anti-SDIM1 antibody .

Experimental Data

Table 1: SDIM1 Transcript Levels in AD and Control Brains

SampleConditionSDIM1 Transcript Level (Relative Quantification)
1Control1.00
2Control0.95
3Control1.10
4AD0.45
5AD0.50
6AD0.60
.........

Table 2: Effects of SDIM1 Overexpression on Cell Viability after OGD Treatment

ConditionCell Viability (%)
Control (pEGFP-N1 vector)60
SDIM1 Overexpression85

Table 3: SDIM1 Expression in Different Cell Types

Cell TypeSDIM1 Transcript Level (Relative Quantification)
Undifferentiated NT2 cells0.1
NT2 derived astrocytes0.15
NT2 neurons1.0

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDIM1; Stress-responsive DNAJB4-interacting membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-146
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
SDIM1
Target Protein Sequence
CGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAINLGFPSPPLVQLIFWSLNAGLDLYLCL ISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVICRLDQHIFSGFTKSLKNLPPCHRTDI
Uniprot No.

Target Background

Function
Promotes neuronal cell survival under stress conditions.
Database Links

HGNC: 38749

STRING: 9606.ENSP00000441459

UniGene: Hs.722069

Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain with higher detection in neurons than astrocytes. Decreased expression in Alzheimer brains. Detected at protein level in brain and cervix.

Q&A

What is the basic structure of SDIM1 protein?

SDIM1 is a small membrane protein with a molecular weight of approximately 13 kDa. Its predicted primary structure contains a typical N-terminal signal peptide of 26 amino acids. The protein features two primary transmembrane helices spanning amino acids 69 to 91 and 97 to 119, respectively. This structural arrangement suggests that SDIM1 is anchored in cellular membranes, which is consistent with its predicted localization .

Researchers investigating SDIM1 structure should consider utilizing techniques such as circular dichroism or crystallography to further elucidate its three-dimensional conformation, particularly focusing on how its membrane-spanning domains may influence its interaction with binding partners.

How does SDIM1 interact with DNAJB4?

SDIM1 forms a direct protein-protein interaction with DNAJB4, a heat shock protein hsp40 homolog. This interaction has been confirmed through both yeast two-hybrid screening and co-immunoprecipitation approaches, demonstrating binding both in vitro and in vivo .

To investigate this interaction in your research, consider:

  • Using co-immunoprecipitation with anti-GST antibodies when working with GST-SDIM1 fusion proteins

  • Employing fluorescently tagged constructs (e.g., SDIM1-EGFP) to visualize interaction dynamics

  • Performing competition assays to identify the specific binding domains involved

The binding of SDIM1 to DNAJB4 appears to sequester DNAJB4, which may explain the observed increase in cell viability when SDIM1 is overexpressed in the presence of DNAJB4 .

What expression patterns does SDIM1 show in neuronal cells?

SDIM1 is more abundantly expressed in neurons compared to astrocytes. Within neurons, SDIM1 is distributed throughout the cytoplasm and neural processes but is notably absent from nuclei . This distribution pattern suggests SDIM1 may have roles in neuronal function that extend beyond the cell body.

How does SDIM1 respond to cellular stress conditions?

SDIM1 exhibits a distinctive biphasic response to cell death-inducing injuries. The initial response is downregulation of SDIM1 expression during the acute phase of injury, followed by significant upregulation in surviving cells during the recovery period .

In experimental models using oxygen-glucose deprivation (OGD):

  • SDIM1 mRNA is significantly downregulated after 2 hours of OGD treatment

  • During a 16-hour recovery period following OGD, SDIM1 becomes significantly upregulated

  • Protein level changes, as verified by Western blot analysis, follow the same pattern as mRNA changes

  • This response pattern is observed in both NT2 neurons and cultured mouse primary neurons

For researchers studying SDIM1's stress response, it is recommended to use time-course experiments with multiple sampling points to capture both the initial downregulation and subsequent upregulation phases.

What mechanisms regulate SDIM1 protein levels in cells?

Experimental evidence suggests that SDIM1 protein levels are tightly regulated through post-transcriptional mechanisms. When SDIM1 is overexpressed in cell culture models:

  • Protein levels gradually increase from 16 to 21 hours post-transfection

  • After reaching peak expression at 21 hours, SDIM1 protein levels decline rapidly

  • By 24 hours post-transfection, despite sustained high mRNA levels, protein levels return to baseline (similar to untransfected controls)

This pattern strongly indicates the existence of a degradation mechanism that controls SDIM1 protein levels. For researchers investigating SDIM1 expression, timing of experiments is critical - the 21-hour post-transfection timepoint appears optimal for studying overexpression effects .

What is the role of SDIM1 in Alzheimer's Disease pathology?

SDIM1 is significantly downregulated in Alzheimer's Disease (AD) brains. This downregulation has been confirmed through quantitative RT-PCR analysis of post-mortem human brain samples from AD patients compared to control subjects .

The protein's response to stress conditions that mimic neurodegeneration in AD brains suggests it may have a neuroprotective function. SDIM1 downregulation may contribute to neuronal vulnerability in AD, while its upregulation in surviving neurons might represent a compensatory protective mechanism .

For researchers studying SDIM1 in AD contexts, comparing expression levels across different brain regions and correlating with markers of disease progression could provide valuable insights into its potential role in disease pathogenesis.

What are effective methods for overexpressing SDIM1 in cellular models?

To effectively overexpress SDIM1 in cellular models:

  • Clone the coding region of SDIM1 into a mammalian expression vector (e.g., pEGFP-N1)

  • Insert a stop codon between the end of SDIM1 and the beginning of any reporter tag (like EGFP) if untagged protein is desired

  • Transfect neuronal cell lines (such as N2a cells) using standard transfection protocols

  • Harvest cells at 21 hours post-transfection for optimal SDIM1 expression

  • Verify overexpression using Western blot analysis with anti-SDIM1 antibodies

When designing SDIM1 overexpression experiments, it's important to account for the rapid degradation of the protein after it reaches peak expression. Time-course analyses are recommended to determine the optimal harvest time for your specific experimental system.

How can researchers effectively knockdown SDIM1 expression?

For effective SDIM1 knockdown:

  • Use a mixture of four siRNAs targeting human SDIM1 to ensure complete knockdown

  • Transfect target cells (e.g., NT2 neurons) using standard siRNA transfection protocols

  • Allow 24 hours for knockdown to take effect

  • Verify knockdown efficiency at both mRNA level (using qRT-PCR) and protein level (using Western blot)

  • Proceed with experimental treatments (such as OGD) after confirming knockdown

When conducting knockdown experiments, it's critical to include appropriate controls, such as non-targeting siRNA, to distinguish specific effects of SDIM1 knockdown from non-specific effects of the transfection procedure.

What assays are best suited for studying SDIM1's role in neuroprotection?

To investigate SDIM1's neuroprotective functions:

  • Oxygen-Glucose Deprivation (OGD) Model:

    • Subject neuronal cultures to OGD for 2-6 hours

    • Allow 16 hours of recovery with normal oxygen and glucose

    • Assess cell viability using methods such as MTT assay or trypan blue exclusion

    • Compare survival between SDIM1-overexpressing, SDIM1-knockdown, and control cells

  • Apoptosis Assays:

    • Co-express SDIM1 with DNAJB4 (which normally reduces cell viability)

    • Measure apoptotic markers through flow cytometry or caspase activity assays

    • Quantify the attenuating effect of SDIM1 on DNAJB4-induced cell death

  • Dimerization Studies:

    • Use co-immunoprecipitation with differentially tagged SDIM1 constructs

    • Combine GST-SDIM1 fusion proteins with cellular proteins from cells transfected with SDIM1-EGFP

    • Detect interactions using antibodies against the different tags

What is known about SDIM1 dimerization properties?

SDIM1 demonstrates the ability to form both homodimers and heterodimers, which may be crucial for its function. Research data on SDIM1 dimerization includes:

Dimer TypeDetection MethodExperimental ApproachObservation
SDIM1-SDIM1 HomodimersCo-immunoprecipitationGST-SDIM1 fusion proteinGST-SDIM1 forms dimers detected by anti-GST antibody
SDIM1-SDIM1-EGFP HeterodimersCo-immunoprecipitationMixing GST-SDIM1 with SDIM1-EGFP transfected cell extractsDetected using both anti-GST and anti-EGFP antibodies
SDIM1-EGFP Self-dimersWestern blotTotal cellular proteins from SDIM1-EGFP transfected cellsFaint band indicating dimerization

The homodimerization activity of SDIM1 has been identified as one of its key functional capabilities, pointing to potential roles in protein complex formation that may be relevant to its neuroprotective effects .

How does SDIM1 affect cell viability under stress conditions?

SDIM1 demonstrates significant effects on neuronal survival under stress conditions. The following table summarizes experimental findings:

Experimental ConditionSDIM1 StatusCell TypeTreatmentOutcome
OverexpressionIncreasedN2a cellsNormal conditionsNo significant change in viability
OverexpressionIncreasedN2a cellsOGD challengeSignificant decrease in cell death compared to control
KnockdownDecreasedNT2 cells6h OGD + 16h re-oxygenationAccelerated cell death compared to control
Co-expression with DNAJB4IncreasedCell line not specifiedDNAJB4 expressionAttenuated DNAJB4-induced cell death

These results strongly suggest that SDIM1 plays a protective role in neurons exposed to stress conditions. The attenuation of DNAJB4-induced cell death by SDIM1 co-expression indicates that the binding of SDIM1 to DNAJB4 might sequester DNAJB4, thereby increasing cell viability .

What are potential therapeutic applications of SDIM1 in neurodegenerative diseases?

Given SDIM1's neuroprotective properties and its downregulation in Alzheimer's Disease, several therapeutic applications warrant investigation:

  • Gene Therapy Approaches: Developing methods to upregulate or deliver SDIM1 to vulnerable neuronal populations in early-stage neurodegenerative disease

  • Small Molecule Development: Identifying compounds that can mimic SDIM1's interaction with DNAJB4, potentially blocking the pro-apoptotic effects of DNAJB4

  • Biomarker Development: Exploring SDIM1 levels in cerebrospinal fluid or blood as potential biomarkers for neurodegeneration progression

  • Combination Therapies: Investigating whether SDIM1-based interventions could enhance the efficacy of existing treatments for neurodegenerative conditions

For researchers pursuing these directions, initial focus should be on validating SDIM1's protective effects in animal models of neurodegeneration before proceeding to therapeutic development .

How might SDIM1 research intersect with other stress-response pathways?

SDIM1 research intersects with several stress-response pathways that warrant further investigation:

  • Heat Shock Response: Given SDIM1's interaction with DNAJB4 (a heat shock protein homolog), exploring how SDIM1 functions within the broader heat shock response network could reveal additional regulatory mechanisms

  • Unfolded Protein Response (UPR): SDIM1's involvement in protein folding suggests potential crosstalk with UPR pathways, which are increasingly implicated in neurodegenerative diseases

  • Autophagy Pathways: Investigating whether SDIM1 influences autophagy, particularly selective autophagy of damaged organelles during cellular stress

  • Oxidative Stress Responses: Examining if SDIM1 participates in cellular defense against oxidative damage, a common feature in neurodegenerative conditions

Researchers should consider employing systems biology approaches to map SDIM1's position within these interconnected stress-response networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.