Recombinant Human Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDHC; CYB560; SDH3; Succinate dehydrogenase cytochrome b560 subunit, mitochondrial; Integral membrane protein CII-3; QPs-1; QPs1; Succinate dehydrogenase complex subunit C; Succinate-ubiquinone oxidoreductase cytochrome B large subunit; CYBL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-169
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
LGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSA LLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLY QSGVVVLVLTVLSSMGLAAM
Uniprot No.

Target Background

Function

Function: This protein is a membrane-anchoring subunit of succinate dehydrogenase (SDH), a crucial component of complex II in the mitochondrial electron transport chain. Its primary role is to facilitate electron transfer from succinate to ubiquinone (coenzyme Q).

Gene References Into Functions

Related Research: SDHC gene alterations and their association with various conditions are extensively documented in the literature. Key findings include:

  • Links to Parasympathetic Paragangliomas (PMID: 29126304)
  • Association with a significant percentage of paragangliomas in French Canadians (PMID: 27700540)
  • Correlation with metastatic sympathetic paraganglioma (PMID: 26162468)
  • Evidence of Paraganglioma development via SDHC promoter methylation (PMID: 26652933)
  • Impact on colorectal carcinoma survival (PMID: 26377099)
  • Role in the pathogenesis of SDH-deficient gastrointestinal stromal tumors (PMID: 25540324)
  • Association with hepatocellular carcinoma (PMID: 25081338)
  • Epigenetic inactivation as a potential mechanism in Carney Triad (PMID: 24859990)
  • Importance in thoracic paraganglioma surveillance (PMID: 24758179)
  • Studies illustrating variable clinical presentations despite identical genotypes (PMID: 24423348)
  • Absence of SDHC mutations in sporadic paraganglioma cases (PMID: 22566194)
  • Potential role in renal cell carcinoma pathogenesis (PMID: 22351710)
  • Case report illustrating synchronous paragangliomas (PMID: 21106325)
  • Radiation sensitization mediated by increased oxidative stress (PMID: 21268708)
  • Association with autosomal dominant malignant paraganglioma (PMID: 12658451)
  • Confirmation of SDHC's role in familial and sporadic paragangliomas (PMID: 15342702)
  • Mutant protein's contribution to tumorigenesis through oxidative stress (PMID: 15665296)
  • Minor role of SDHC germline mutations in sporadic head and neck paraganglioma (PMID: 16405730)
  • Potential role in familial gastrointestinal stromal tumors (PMID: 17804857)
  • Significance of SDHD and SDHC gene deletions in paraganglioma (PMID: 19546167)
Database Links

HGNC: 10682

OMIM: 602413

KEGG: hsa:6391

STRING: 9606.ENSP00000356953

UniGene: Hs.444472

Involvement In Disease
Paragangliomas 3 (PGL3); Paraganglioma and gastric stromal sarcoma (PGGSS)
Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of human SDHC protein?

The human SDHC protein (Succinate dehydrogenase complex subunit C) is an 18.6 kDa protein composed of 169 amino acids that forms one of the four subunits of succinate dehydrogenase (Complex II). SDHC functions as one of two integral membrane proteins that anchor the catalytic core of the complex to the inner mitochondrial membrane . The gene encoding SDHC is located on chromosome 1 at position q21 and is partitioned into six exons .

SDHC plays a crucial role in both the tricarboxylic acid cycle and aerobic respiratory chains within mitochondria. It partners with SDHD to form a transmembrane dimer that anchors the SDHB electron transport subunit, which in turn connects to the SDHA subunit . This arrangement facilitates the transfer of electrons from succinate to ubiquinone (coenzyme Q) in the mitochondrial electron transport chain .

Methodologically, studying the structure of SDHC typically involves techniques such as X-ray crystallography, cryo-electron microscopy, and computational modeling to elucidate its transmembrane domains and interaction interfaces.

How does recombinant SDHC integrate into the succinate dehydrogenase complex?

Recombinant SDHC integration into the succinate dehydrogenase complex requires a coordinated assembly process involving several dedicated assembly factors. The process begins with proper expression and targeting of the protein to mitochondria, followed by insertion into the inner mitochondrial membrane and association with other complex subunits.

The assembly of the complete SDH complex is intricate, involving a multi-step mechanism . Several proteins are essential for this process, as outlined in the table below:

Assembly FactorSubcellular LocationFunction in SDH Assembly
SDHAF2/Sdh5/SdhEMitochondrial matrixRegulator/chaperone for SDHA flavination
SDHAF4/Sdh8Mitochondrial matrixChaperone for SDHA-FAD, promotes Sdh1–Sdh2 dimerization

When working with recombinant SDHC, researchers must ensure proper post-translational modifications and membrane integration. Experimental approaches often include co-expression with other SDH subunits in suitable expression systems, followed by isolation of intact complexes using techniques like blue native PAGE or sucrose gradient ultracentrifugation.

What mutations in SDHC are associated with human diseases?

SDHC mutations have been specifically associated with paragangliomas and pheochromocytomas, which are rare neuroendocrine tumors . These conditions are collectively known as Pheochromocytoma/Paraganglioma Syndrome 3 . Additionally, SDHC mutations have been linked to paraganglioma and gastric stromal sarcoma .

When investigating SDHC mutations, researchers should employ comprehensive genetic screening approaches including:

  • Targeted sequencing of the SDHC gene (located on chromosome 1)

  • Analysis of all six exons and splice junctions

  • Assessment of large deletions/duplications using MLPA or array CGH

  • Functional validation of novel variants using recombinant expression systems

For clinical correlation studies, it's important to collect detailed phenotypic data including tumor location, catecholamine production, malignancy potential, and family history. The genotype-phenotype correlation analysis requires sophisticated statistical approaches to handle the variable penetrance and expressivity observed in SDHC mutation carriers.

How do assembly factors influence recombinant SDHC integration into Complex II?

Assembly factors play crucial roles in ensuring proper SDHC integration into Complex II. While SDHC itself forms part of the membrane anchor component, its proper incorporation depends on the coordinated assembly of all four subunits and associated assembly factors.

Research has identified several proteins essential for SDH complex assembly, particularly focusing on the flavination of SDHA and the proper formation of subunit interactions . For example, SDHAF2 (humans)/Sdh5 (yeast)/SdhE (bacteria) functions as a regulator/chaperone for SDHA flavination in the mitochondrial matrix . Similarly, SDHAF4 (humans and Drosophila)/Sdh8 (yeast) acts as a chaperone for SDHA-FAD and promotes dimerization of Sdh1–Sdh2 .

When working with recombinant SDHC, researchers should consider co-expressing these assembly factors to enhance proper complex formation. In vitro studies on recombinant human SdhA have demonstrated the necessity of SDHAF2 for flavination . Methodologically, this can be achieved through:

  • Co-expression systems in suitable host cells

  • Sequential purification strategies to isolate intact complexes

  • Activity assays to confirm functional assembly

  • Structural analyses to verify proper integration

Researchers should also investigate whether SDHC has specific assembly factors dedicated to its membrane integration, as this remains an area with knowledge gaps.

What experimental approaches best capture SDHC interactions with other complex II components?

Capturing the interactions between SDHC and other Complex II components requires specialized experimental approaches due to the transmembrane nature of SDHC and the complexity of mitochondrial protein assemblies.

Recommended methodological approaches include:

  • Crosslinking-Mass Spectrometry (XL-MS): This technique captures transient interactions by chemically crosslinking proteins in their native environment before MS analysis.

  • Proximity-Based Labeling: BioID or APEX2 fusions to SDHC can identify proximal proteins in living cells.

  • Co-Immunoprecipitation with Membrane-Compatible Detergents: Using mild detergents like digitonin or DDM that preserve membrane protein interactions.

  • Blue Native PAGE: Allows separation of intact membrane protein complexes under non-denaturing conditions.

  • Förster Resonance Energy Transfer (FRET): For studying dynamic interactions between fluorescently tagged subunits.

How can researchers distinguish between direct and indirect effects of SDHC dysfunction?

Distinguishing between direct and indirect effects of SDHC dysfunction presents a significant challenge in mitochondrial research. SDHC's dual role in the TCA cycle and electron transport chain means its dysfunction can have cascading effects throughout cellular metabolism.

A systematic approach to this question includes:

  • Time-Course Experiments: Tracking changes immediately following SDHC inhibition/depletion versus long-term adaptations.

  • Metabolic Flux Analysis: Using stable isotope-labeled metabolites to trace the flow through affected pathways.

  • Genetic Complementation Studies: Rescuing SDHC deficiency with wild-type or mutant variants to identify which phenotypes are directly rescued.

  • Proximity-Based Proteomics: Identifying proteins whose association with SDHC changes under different conditions.

  • Pharmacological Intervention: Using specific inhibitors of downstream pathways to block indirect effects.

Analysis of these complex datasets should follow rigorous statistical methods as outlined in contemporary SCED standards . This includes establishing appropriate baselines, managing autocorrelation in sequential observations, and careful interpretation of effect sizes in single-subject experiments .

What single-case experimental designs are most appropriate for studying SDHC mutations?

When investigating rare SDHC mutations or specific cellular responses to SDHC manipulation, Single-Case Experimental Designs (SCEDs) offer powerful and flexible alternatives to large sample group designs. Based on systematic review findings, appropriate SCED approaches for SDHC research include:

  • Multiple Baseline Design: Particularly valuable when studying the effects of SDHC mutations across different cell lines or tissues simultaneously, allowing for staggered intervention timing.

  • Reversal/Withdrawal Designs (ABAB): Useful for studying interventions targeting SDHC function that can be applied and removed, such as pharmacological inhibitors or inducible expression systems.

  • Changing Criterion Design: Appropriate when studying dose-dependent effects of SDHC modulation.

  • Alternating Treatment Design: Valuable for comparing different interventions targeting SDHC or its associated pathways.

When implementing these designs, researchers should adhere to contemporary quality standards including:

  • Establishing representative baselines with 3-5 data points minimum per phase

  • Addressing autocorrelation in sequential observations

  • Using appropriate analytic methods (visual analysis remains predominant but statistical approaches are increasingly common)

  • Managing missing observations appropriately

The systematic review of SCED research indicates that published studies largely conform to experimental quality criteria, though analytic methods remain an area of ongoing development .

What are the recommended experimental controls when studying recombinant human SDHC?

When studying recombinant human SDHC, implementing appropriate controls is crucial for obtaining reliable and interpretable results. Based on current best practices in the field, researchers should consider the following control strategies:

The experimental design should follow the guidelines from systematic reviews of single-case experimental designs, ensuring sufficient baseline measures and appropriate analysis methods . When possible, time-series approaches with multiple measurements should be employed to capture the dynamic nature of SDHC integration and function.

How should researchers prepare and validate recombinant SDHC protein for functional studies?

Preparing and validating recombinant SDHC protein presents unique challenges due to its transmembrane nature and involvement in multi-subunit complexes. A comprehensive workflow includes:

  • Expression System Selection:

    • Mammalian expression systems (HEK293, CHO) for proper post-translational modifications

    • Insect cell systems (Sf9, High Five) for higher yield

    • Cell-free systems for difficult-to-express constructs

  • Construct Design Considerations:

    • Codon optimization for expression host

    • Affinity tags positioned to avoid interference with membrane insertion

    • Signal sequences for proper targeting

  • Purification Strategy:

    • Detergent selection critical for maintaining structure (digitonin, DDM commonly used)

    • Two-step purification (e.g., affinity followed by size exclusion)

    • Quality control at each step

  • Validation Approaches:

    • Western blotting for expression and size verification

    • Mass spectrometry for protein identification and modification analysis

    • Circular dichroism for secondary structure assessment

    • Activity assays (electron transfer capability)

    • Membrane integration assays

When documenting results, researchers should prepare comprehensive data tables following established guidelines , ensuring all experimental variables and conditions are clearly recorded. This approach facilitates reproducibility and proper interpretation of SDHC functional characteristics.

How should researchers interpret contradictory results in SDHC functional studies?

When encountering contradictory results in SDHC functional studies, researchers should employ a systematic approach to identify potential sources of discrepancy:

  • Methodological Differences Assessment:

    • Expression systems used (bacterial, yeast, insect, mammalian)

    • Purification methods and detergents employed

    • Assay conditions (pH, temperature, buffer composition)

    • Presence or absence of assembly factors

  • Construct Variation Analysis:

    • Tag position and type differences

    • Truncations or mutations

    • Species differences in SDHC homologs

  • Statistical Reanalysis:

    • Evaluate whether appropriate statistical methods were applied

    • Consider power limitations in studies with small sample sizes

    • Apply contemporary SCED analysis approaches when applicable

  • Biological Context Consideration:

    • Cell type-specific effects

    • Metabolic state variations

    • Compensatory mechanisms

  • Resolution Strategies:

    • Direct side-by-side comparison under identical conditions

    • Collaborative validation across laboratories

    • Meta-analysis approaches when multiple studies exist

Remember that SDHC functions within the complex environment of the inner mitochondrial membrane and as part of a multi-subunit complex. Differences in assembly factor availability (such as SDHAF2 or SDHAF4) can significantly impact results, particularly in reconstitution experiments.

What statistical approaches are most appropriate for analyzing SDHC mutation effects?

When analyzing SDHC mutation effects, researchers should select statistical approaches based on experimental design and data characteristics:

  • For Cell-Based Functional Studies:

    • ANOVA with appropriate post-hoc tests for comparing multiple mutations

    • Mixed-effects models when accounting for batch effects or repeated measures

    • Non-parametric alternatives when normality assumptions are violated

  • For Biochemical Characterization:

    • Enzyme kinetics analysis (Michaelis-Menten, Lineweaver-Burk plots)

    • Binding affinity comparisons (KD determination)

    • Thermodynamic stability analysis

  • For Single-Case Experimental Designs:

    • Visual analysis remains the most common and supported method

    • Specialized SCED statistics (e.g., Tau-U, Hedges' g for single-case designs)

    • Time-series analysis approaches accounting for autocorrelation

  • For Clinical/Genetic Association Studies:

    • Penetrance and expressivity calculations

    • Kaplan-Meier analysis for age-dependent phenotypes

    • Odds ratio determination for disease association

How can researchers effectively present SDHC research data in publications?

Effectively presenting SDHC research data in publications requires careful attention to data organization, visualization, and contextual information:

  • Data Table Construction:

    • Follow established guidelines for scientific data tables

    • Include all relevant experimental variables

    • Present comparative data in tables rather than lists

    • Ensure clear column headers and units

    • Include statistical measures (n, p-values, confidence intervals)

  • Figure Preparation:

    • Show representative images alongside quantification

    • Use consistent formatting across related figures

    • Include molecular weight markers on all blots

    • Provide both overview and detailed images for localization studies

    • Use color schemes accessible to color-blind readers

  • Statistical Reporting:

    • Clearly state statistical tests used

    • Report exact p-values rather than thresholds

    • Include effect sizes alongside significance tests

    • Report confidence intervals where appropriate

    • Distinguish between technical and biological replicates

  • Methodological Transparency:

    • Provide detailed protocols or references

    • Specify reagent sources, including antibody validation

    • Report negative or contradictory results

    • Share raw data through repositories when possible

When presenting SCED research results, researchers should include sufficient baseline data (minimum 3-5 points) and address how they managed challenges such as autocorrelation and missing observations . Data tables should be structured to facilitate comparison across experimental conditions while maintaining clarity and completeness .

Why might recombinant human SDHC fail to integrate properly into the mitochondrial membrane?

Recombinant human SDHC may fail to properly integrate into the mitochondrial membrane for several reasons, each requiring specific troubleshooting approaches:

  • Expression System Issues:

    • Absence of mitochondrial import machinery in bacterial systems

    • Improper post-translational modifications in non-mammalian systems

    • Insufficient expression of assembly factors

    Solution: Consider switching to mammalian or mitochondria-containing expression systems; co-express with assembly factors like SDHAF2 and SDHAF4 .

  • Construct Design Problems:

    • Interference from affinity tags near transmembrane domains

    • Missing targeting sequences

    • Disruption of interaction interfaces

    Solution: Redesign constructs with tags in non-critical regions; include proper mitochondrial targeting sequences; verify transmembrane domain integrity.

  • Assembly Partner Availability:

    • Insufficient levels of SDHD (dimerization partner)

    • Absence of SDHB and SDHA for complete complex formation

    • Limited assembly factors

    Solution: Co-express with other complex components; supplement with assembly factors like SDHAF2 for flavination .

  • Membrane Environment Factors:

    • Inappropriate detergent selection disrupting membrane integration

    • Lipid composition differences affecting insertion

    • pH or ionic strength issues

    Solution: Test multiple detergent types and concentrations; consider lipid supplementation; optimize buffer conditions.

  • Quality Control Mechanisms:

    • Degradation by mitochondrial quality control pathways

    • Protein misfolding leading to aggregation

    • Endoplasmic reticulum-associated degradation before reaching mitochondria

    Solution: Use protease inhibitors; optimize growth temperature; consider chaperone co-expression.

Experimental design should incorporate appropriate controls and follow established SCED principles where applicable , including sufficient baseline measurements and analysis of potential confounding factors.

What are common artifacts in SDHC antibody-based detection methods?

Antibody-based detection of SDHC presents several potential artifacts that researchers should be aware of and control for:

  • Cross-Reactivity Issues:

    • Antibodies recognizing other SDH subunits (particularly SDHA/SDHB)

    • Detection of SDHC pseudogene products (several are known )

    • Non-specific binding to other mitochondrial membrane proteins

    Solution: Validate antibodies using SDHC knockout controls; perform peptide competition assays; test multiple independent antibodies.

  • Conformational Epitope Masking:

    • Complex formation hiding antibody epitopes

    • Detergent effects on protein conformation

    • Post-translational modifications blocking recognition

    Solution: Use multiple antibodies targeting different epitopes; optimize gentle extraction conditions; test native vs. denatured detection.

  • Background Signal Problems:

    • High mitochondrial autofluorescence in imaging

    • Non-specific secondary antibody binding

    • Endogenous peroxidase activity in IHC/Western blots

    Solution: Include no-primary controls; use specific blocking reagents; apply appropriate quenching protocols.

  • Quantification Challenges:

    • Extraction efficiency variations between samples

    • Loading control selection (mitochondrial vs. whole-cell)

    • Signal saturation in highly expressed samples

    Solution: Use mitochondria-specific loading controls (e.g., VDAC); ensure linear detection range; normalize to mitochondrial mass.

  • Fixation and Processing Artifacts:

    • Epitope masking during fixation

    • Membrane protein extraction inefficiency

    • Aggregation during sample processing

    Solution: Optimize fixation protocols; use membrane-compatible extraction methods; prevent freeze-thaw cycles.

When designing experiments and analyzing results, researchers should follow established methodological guidelines and consider SCED principles where appropriate , particularly establishing stable baselines and addressing potential confounding variables.

How can researchers troubleshoot issues with recombinant SDHC activity assays?

Troubleshooting recombinant SDHC activity assays requires systematic identification and resolution of potential issues throughout the experimental workflow:

  • Complex Assembly Problems:

    • Incomplete assembly of the four-subunit complex

    • Improper incorporation of cofactors (FAD, iron-sulfur clusters, heme)

    • Missing assembly factors

    Solution: Verify complex integrity via BN-PAGE; ensure co-expression of all subunits; supplement with assembly factors like SDHAF2 and SDHAF4 .

  • Substrate and Cofactor Issues:

    • Succinate purity or concentration

    • Ubiquinone analog selection and concentration

    • Artificial electron acceptor compatibility

    Solution: Use analytical grade substrates; test multiple electron acceptors; optimize substrate concentrations with Michaelis-Menten analysis.

  • Assay Condition Optimization:

    • pH and buffer composition effects

    • Temperature sensitivity

    • Oxygen levels and oxidation

    Solution: Perform condition matrices to identify optimal parameters; consider anaerobic chambers for oxygen-sensitive experiments.

  • Detection Method Limitations:

    • Spectrophotometric interference from sample components

    • Fluorescence quenching

    • Insufficient sensitivity for low activity levels

    Solution: Include appropriate blanks; consider alternative detection methods; implement signal amplification where needed.

  • Data Analysis Challenges:

    • Nonlinear reaction kinetics

    • Background activity from contaminants

    • Normalization method selection

    Solution: Ensure measurements in linear range; include enzyme-free controls; normalize to complex quantity rather than total protein.

When analyzing troubleshooting data, researchers should follow appropriate experimental design principles, including establishing sufficient baseline measurements (3-5 data points minimum) and accounting for potential autocorrelation in sequential measurements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.