Recombinant Human Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Characteristics

SDHD is a 159-amino acid transmembrane protein (1–159 aa) that forms a heterodimer with SDHC to anchor the SDH complex (Complex II) to the inner mitochondrial membrane . Key structural and functional features include:

FeatureDescription
Molecular Weight~15 kDa (anchor subunit)
Expression SystemWheat germ, E. coli, yeast, or mammalian cells (varies by producer)
Post-Translational TagsN-terminal His-tag (common in recombinant variants)
Core Functions- Anchors SDH to mitochondrial membrane
- Facilitates ubiquinone reduction
- Regulates electron transfer from FADH₂ to ubiquinone

The SDHC/SDHD dimer binds ubiquinone and transfers electrons via a [3Fe-4S] iron-sulfur cluster, enabling succinate oxidation in the TCA cycle and linking the citric acid cycle to oxidative phosphorylation .

Applications in Research

Recombinant SDHD is used in diverse experimental contexts:

ApplicationDetails
Protein-Protein InteractionsStudying dimerization with SDHC and interactions with SDHB
Electron Transport AssaysMonitoring ubiquinone reduction kinetics in vitro
Cancer ResearchInvestigating promoter mutations linked to melanoma and paragangliomas
Immunological StudiesAnalyzing SDHD’s role in macrophage inflammation and ROS production

Genetic and Clinical Significance

SDHD mutations are strongly associated with familial paragangliomas and pheochromocytomas. Key findings include:

Founder Mutations

  • p.Cys11X (c.33C>A): A common founder mutation in European populations, linked to hereditary paragangliomas .

  • Haplotype Analysis: Identical mutations in unrelated families suggest a shared ancestral origin (e.g., Poland) .

Promoter Mutations in Melanoma

Recurrent promoter mutations (e.g., C523T, C544T) disrupt GABPA/B1 transcription factor binding, reducing SDHD expression and correlating with poor prognosis .

MutationEffect on SDHD ExpressionClinical Association
C523TLoss of GABPA bindingMelanoma progression
C544TImpaired transcriptional activationReduced survival rates

Recombinant Production and Purification

SDHD is produced via heterologous expression systems, with variations in methodology:

ParameterDetails
Expression HostWheat germ (full-length), E. coli (partial), mammalian cells (modified)
PurificationSDS-PAGE, ELISA, Western blot (common validation methods)
Functional ValidationUbiquinone reduction assays, subunit assembly tests

Role in Inflammation and ROS

  • SDHD activity oxidizes succinate to fumarate, suppressing HIF-1α stabilization and IL-1β production in macrophages .

  • Inhibition of SDHB/SDHC/SDHD increases mitochondrial ROS, promoting tumor growth, while SDHA inhibition has opposing effects .

Challenges in Cell Modeling

  • Human SDHD-related paraganglioma cells are difficult to culture long-term due to mitochondrial dysfunction .

  • Rodent models (e.g., RS0 cell line) require hypoxic conditions and stem cell factors for survival .

Comparative Analysis of Recombinant Variants

SourceExpression SystemTagKey Use Case
Abcam (ab116859)Wheat germNoneSDS-PAGE, ELISA
Creative BioMartE. coliN-terminal HisStructural studies
MyBioSourceMammalian cellsProtein AAntibody production

Future Directions

  • Therapeutic Targeting: Exploiting SDHD’s role in tumorigenesis for cancer therapies.

  • Structural Biology: Resolving the atomic structure of SDHC/SDHD dimerization.

  • Epigenetic Studies: Investigating promoter mutations beyond melanoma (e.g., other cancers).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on your purchase method and location. For specific delivery time estimates, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SDHD; SDH4; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; CII-4; QPs3; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
57-159
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVH GDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
Uniprot No.

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Gene References Into Functions
  1. In a study of 25 Mexican patients with carotid body tumors, 4 exhibited a heterozygous p81L SDHD (11q23) gene mutation. This occurrence is higher than the rate observed in the U.S. population and might explain the elevated incidence of this pathology in Mexico. PMID: 29681642
  2. Mutations in any of the five genes encoding the succinate dehydrogenase or mitochondrial complex II lead to corresponding familial syndromes characterized by the presence of pheochromocytomas and paragangliomas—REVIEW. PMID: 28924001
  3. A targeted familial genetic test should be considered from the age of 18 years for individuals with a mother carrying a germline SDHD mutation. An initial medical workup, including imaging, is recommended for SDHD-positive mutation carriers. PMID: 27856506
  4. Loss of the SDHD gene is associated with paragangliomas. PMID: 28099933
  5. Promoter mutations appear to be infrequent in CM, but lower SDHD expression might correlate with poorer prognostic features in CM. PMID: 28662141
  6. GABPA/B1 act as critical ETS transcription factors that dysregulate SDHD expression in the context of highly recurrent promoter mutations in melanoma. PMID: 28108517
  7. Mortality rates and survival in a Dutch cohort of SDHD variant carriers do not differ significantly from the general Dutch population. PMID: 25758995
  8. Melanomas harbor recurrent SDHD promoter mutations, primarily occurring as C>T alterations in UV-exposed melanomas. PMID: 26327518
  9. Loss of SDH activity results in metabolic alterations affecting non-essential amino acids. PMID: 26522426
  10. Metabolic sensors via Sirt3 optimize cellular reserve respiratory capacity by activating mitochondrial complex II, enhancing cell survival after hypoxic conditions. PMID: 26225774
  11. Evidence suggests that double pathogenic mutations in the succinate dehydrogenase complex subunit D (SDHD) gene are associated with the aggressive paraganglioma syndrome type 1 (PGL1) phenotype. PMID: 25819804
  12. It is proposed that SDHD mutation might contribute to the overexpression of miR-101 in malignant tumors, making miR-101 a potential diagnostic biomarker for differentiating malignant and benign pheochromocytoma. PMID: 25973039
  13. Hereditary pheochromocytoma / paraganglioma linked to SDHD gene mutations exhibits a more aggressive course, often involving both adrenal glands, a higher recurrence rate, and earlier onset of disease manifestations. PMID: 26591561
  14. Autosomal dominant susceptibility for Paraganglioma is influenced by imprinting, and mutations in the SDHD gene cause Paragangliomas only when the mutation is inherited from the father. PMID: 24973967
  15. SDHD deletions have been observed in a group of unrelated patients presenting with developmental delay and partial monosomy at chromosome 11. PMID: 25735893
  16. SDHD mutations are associated with protein and nuclear and mitochondrial genomic instability, leading to increased reactive oxygen species production in a yeast model. PMID: 25328978
  17. A recessive homozygous p.Asp92Gly SDHD mutation causes prenatal cardiomyopathy and a severe mitochondrial complex II deficiency. PMID: 26008905
  18. This study is the first to report hereditary paraganglioma-pheochromocytoma syndromes with both SDHD and RET mutations. PMID: 24375508
  19. Genotype-phenotype correlations were assessed in a large Dutch cohort of SDHD mutation carriers, evaluating potential differences in clinical phenotypes caused by specific SDHD gene mutations. PMID: 23586964
  20. Genome sequencing was performed simultaneously on all subunits (SDHA, SDHB, SDHC, and SDHD) in a larger series of KIT/PDGFRA wild-type GIST to determine the frequency of mutations and explore their biological roles. PMID: 23612575
  21. Findings demonstrate that maternal transmission of SDHD mutations can, in rare instances, contribute to tumorigenesis. PMID: 25300370
  22. Loss of heterozygosity was observed in over 50% of von Hippel-Lindau-associated pheochromocytomas, correlating with a significant decrease (p < 0.05) in both SDHAF2 and SDHD mRNA expression, suggesting a potential pathogenic role. PMID: 24322175
  23. Asymptomatic carriers of an SDHD mutation are at a significantly elevated risk for occult parasympathetic paraganglioma. PMID: 22948026
  24. The high prevalence of the G12S polymorphism of the SDHD gene in patients with multiple endocrine neoplasia type 2A raises questions about its potential role as a genetic modifier, but further research is needed to confirm this hypothesis. PMID: 22584711
  25. Ten distinct SDHD mutations were identified in paraganglioma cases. PMID: 22566194
  26. No mutations were found in the SDHD gene in cases of pheochromocytoma and abdominal paraganglioma in Western Sweden. PMID: 22270996
  27. The first kindred with a germline SDHD pathogenic mutation was described, exhibiting inherited paragangliomas and acromegaly due to a GH-producing pituitary adenoma. PMID: 22170724
  28. Two missense mutations at the start codon of the SDHD gene, including p.Met1Val (c.1A>G) and p.Met1Ile (c.3G>C), might be mutation hotspots in Chinese patients with familial head and neck paragangliomas. PMID: 21945342
  29. A unique combination of demographic, geographical, and historical factors in Trentino, Italy, has resulted in the oldest and largest SDHD founder effect characterized to date, transforming a rare disease (paraganglioma syndrome type 1) into an endemic condition. PMID: 22456618
  30. The data provide molecular evidence for imprinting at a boundary element flanking the SDHD locus, suggesting that epigenetic suppression of the maternal allele is the underlying mechanism for the imprinted penetrance of SDHD mutations. PMID: 21862453
  31. The majority of patients (83%) carried mutations in SDHD, with the p.Asp92Tyr Dutch founder mutation in SDHD alone accounting for 72% of all patients with HNPGL. PMID: 21561462
  32. Pheochromocytoma formation can occur after maternal transmission of SDHD. Tumor formation in SDHD mutation carriers requires the loss of the wild-type SDHD allele and maternal 11p15, leading to a predominant (though not exclusive) inheritance pattern after paternal SDHD transmission. PMID: 21937622
  33. A mutation linked to familial paraganglioma was identified as a deletion at the c.165_169 + 14del sequence. PMID: 21619495
  34. Research discovered a founder effect in Chinese head and neck paraganglioma patients carrying the SDHD c.3G>C mutation. PMID: 21792967
  35. An analysis of SDHD mutations was conducted in patients with pheochromocytomas and paragangliomas. PMID: 20505258
  36. These data describe a large SDHD deletion at the genomic sequence level, indicating that gross SDHD deletions could be a founder paraganglioma mutation in specific populations. PMID: 20111059
  37. Both the risk of developing paraganglioma and phaeochromocytoma, as well as the risk of associated symptoms, were investigated in 243 family members carrying the SDHD.D92Y founder mutation. PMID: 19584903
  38. The R22X mutation of the SDHD gene in hereditary paraganglioma completely eliminates the enzymatic activity of complex II in the mitochondrial respiratory chain and activates the hypoxia pathway. PMID: 11605159
  39. Alterations in the SDHD gene are implicated in the tumorigenesis of both midgut carcinoids and Merkel cell carcinomas. PMID: 12007193
  40. The identification of novel mutations in patients with phaeochromocytoma and/or paraganglioma was reported. PMID: 12111639
  41. A germline mutation in SDHD is associated with parasympathetic paraganglioma. PMID: 12114404
  42. Hereditary paraganglioma caused by the SDHD M1I mutation was observed in a second Chinese family, suggesting a founder effect. PMID: 12782822
  43. SDHD may play a role in colorectal and gastric cancers as a distinct type of tumor suppressor. PMID: 12883710
  44. Deletions of chromosome 11 regions, including the deletion of PGL1 and PGL2 loci, can lead to a severe phenotype, as exemplified by the development of paraganglioma. PMID: 15066320
  45. The presence of a germline mutation in the succinate dehydrogenase subunit D (SDHD) gene was reported. PMID: 15365827
  46. Germline mutations on the SDHD gene were found in patients with pheochromocytoma or functional paraganglioma. PMID: 16314641
  47. Pseudo-hypoxia can be observed in SDH-suppressed cells in the absence of oxidative stress and in the presence of effective antioxidant treatment. PMID: 16797480
  48. The prevalence of paragangliomas in carriers of D92Y mutations is at least 2.5%. PMID: 17227803
  49. The genes most commonly implicated, SDHD and SDHB, also predispose to phaeochromocytoma. SDHD demonstrates a complex inheritance pattern—tumors do not develop if the mutation is inherited from the mother. PMID: 17298303
  50. The mutation was not found in Chinese patients with sporadic pheochromocytoma/paraganglioma. PMID: 17526943

Show More

Hide All

Database Links

HGNC: 10683

OMIM: 114900

KEGG: hsa:6392

STRING: 9606.ENSP00000364699

UniGene: Hs.356270

Involvement In Disease
Paragangliomas 1 (PGL1); Pheochromocytoma (PCC); Intestinal carcinoid tumor (ICT); Paraganglioma and gastric stromal sarcoma (PGGSS); Cowden syndrome 3 (CWS3); Mitochondrial complex II deficiency (MT-C2D)
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of SDHD in mitochondrial function?

Succinate dehydrogenase (SDH), also known as complex II of the mitochondrial electron transport chain, plays a dual role in cellular metabolism by participating in both the citric acid cycle and oxidative phosphorylation. The SDHD subunit specifically anchors the SDH complex to the inner mitochondrial membrane and facilitates electron transfer from succinate to ubiquinone (coenzyme Q) during oxidative phosphorylation . This process is critical for ATP production and cellular energy homeostasis. Additionally, SDHD contributes to stabilizing the larger SDH complex, ensuring its structural integrity .

How is recombinant human SDHD protein produced?

Recombinant human SDHD protein is typically expressed in systems such as wheat germ extract or bacterial systems to ensure high yield and functionality. The protein spans amino acids 1–159 and retains its membrane-anchoring properties necessary for experimental applications such as SDS-PAGE, ELISA, and Western blotting . The choice of expression system is guided by the need for post-translational modifications and structural fidelity required for functional studies.

What are the implications of SDHD mutations in human diseases?

Mutations in SDHD are associated with various pathologies, including hereditary paragangliomas and pheochromocytomas. These mutations disrupt the electron transport chain, leading to succinate accumulation, which acts as an oncogenic metabolite by inhibiting prolyl hydroxylases and stabilizing hypoxia-inducible factors (HIFs) . This dysregulation contributes to tumorigenesis and has been implicated in clear cell renal cell carcinoma (ccRCC) as well .

How can SDHD activity be measured experimentally?

SDHD activity can be assessed using enzymatic assays that monitor succinate oxidation or electron transfer to ubiquinone. ELISA kits designed for succinate dehydrogenase quantification provide a sensitive method for measuring enzyme levels in various biological samples, including serum, plasma, and tissue lysates . These assays often incorporate controls to account for potential confounding factors such as sample hemolysis or freeze-thaw cycles.

What are key variables to consider when studying SDHD function?

In experimental designs involving SDHD, researchers must define independent variables such as genetic mutations or pharmacological inhibitors affecting SDH activity. Dependent variables typically include measures of electron transport efficiency, ATP production rates, or succinate accumulation . Extraneous variables like mitochondrial membrane integrity and sample preparation protocols should be controlled rigorously to ensure valid results.

How can experimental treatments be optimized for studying SDHD?

Experimental treatments may involve manipulating SDHD expression levels through genetic engineering or using inhibitors targeting specific components of the electron transport chain. For example, succinate analogs can be employed to study competitive inhibition at the active site of SDH . Treatments should be validated using dose-response curves and time-course studies to establish optimal conditions.

What methods can be used to study SDHD interactions within the electron transport chain?

Co-immunoprecipitation followed by mass spectrometry can identify protein-protein interactions involving SDHD within complex II. Additionally, cryo-electron microscopy provides structural insights into how SDHD anchors the complex to the mitochondrial membrane . These methods require careful optimization of buffer conditions and cross-linking agents to preserve native interactions.

How does succinate accumulation influence epigenetic regulation?

Succinate accumulation due to impaired SDH activity inhibits α-ketoglutarate-dependent dioxygenases involved in DNA demethylation and histone modification processes . This epigenetic modulation has been linked to oncogenesis in cancers such as ccRCC. Advanced studies often employ chromatin immunoprecipitation sequencing (ChIP-seq) or methylation-specific PCR to investigate these changes.

What are the challenges in modeling SDHD-related diseases in vitro?

Modeling diseases associated with SDHD mutations requires systems that accurately recapitulate mitochondrial dysfunction and metabolic alterations observed in vivo. Primary challenges include maintaining mitochondrial integrity during cell culture and replicating tissue-specific phenotypes . Organoid models derived from patient tissues have emerged as promising tools for addressing these limitations.

How do multifocality and metastasis correlate with specific SDH mutations?

Meta-analyses have demonstrated that multifocal tumors are significantly correlated with SDHD mutations, while distant metastases are more commonly associated with mutations in other subunits like SDHB . These findings highlight the importance of subtype-specific analyses when studying tumor progression mechanisms.

How should samples be prepared for studying recombinant human SDHD?

Sample preparation protocols vary depending on the type of biological material used (e.g., serum, plasma, tissue lysates). For instance:

  • Serum samples should be clotted at room temperature before centrifugation.

  • Plasma samples require anticoagulants such as EDTA or heparin during collection.

  • Tissue homogenates may involve sonication steps followed by centrifugation at high speeds .

Proper storage conditions (e.g., -80°C) are critical for preserving sample integrity.

What controls are necessary for validating experimental results involving SDHD?

Controls should include untreated samples or samples expressing wild-type SDHD alongside those expressing mutant forms. Negative controls lacking key reagents (e.g., substrates or antibodies) help identify non-specific signals . Replicates across multiple experimental runs ensure reproducibility.

How can publication bias be minimized in meta-analyses involving SDHD?

Publication bias can be assessed using funnel plots and Egger's regression tests during meta-analyses . Researchers should include studies from diverse populations and settings to improve generalizability.

What statistical methods are suitable for analyzing SDHD-related data?

Common statistical techniques include regression analyses for correlating mutation types with clinical outcomes and ANOVA for comparing enzyme activity across experimental groups . Advanced methods like Bayesian inference may be employed for more nuanced interpretations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.