Recombinant Human Sulfhydryl oxidase 1 (QSOX1)

Shipped with Ice Packs
In Stock

Description

Introduction to QSOX1

Quiescin sulfhydryl oxidase 1 (QSOX1) is an enzyme that catalyzes the formation of disulfide bonds in proteins, which is essential for their proper folding and stability . QSOX1 belongs to the family of FAD-dependent sulfhydryl oxidases and is highly conserved among eukaryotic organisms, highlighting its significant biological function . The primary enzymatic function of QSOX1 involves oxidizing sulfhydryl groups, leading to the generation of disulfide bonds in proteins and the reduction of oxygen to hydrogen peroxide .

Expression and Localization of QSOX1

QSOX1 is expressed in various tissues and is often localized to the Golgi apparatus and endoplasmic reticulum in human cells . In these locations, it functions independently and in conjunction with protein disulfide isomerase to facilitate the folding of newly synthesized proteins .

Enzymological Characterization

Recombinant human QSOX1 (HsQSOX1) has been expressed and characterized to understand its enzymatic properties . HsQSOX1 exhibits high activity toward reduced ribonuclease A (RNase) and dithiothreitol, but significantly lower activity toward reduced glutathione . Mutational analysis has shown that specific cysteine residues, such as C70, C73, C449, and C452, are crucial for the efficient oxidation of reduced RNase . The residue C452 is identified as the charge-transfer donor to the flavin ring of QSOX1, while C449 is expected to form a mixed disulfide with C70 in the thioredoxin domain .

Role in Tumorigenesis

QSOX1's role in cancer is complex, with studies showing its involvement in both tumor suppression and promotion, depending on the tumor type and stage .

  • Tumor-suppressing effects: High expression of QSOX1 is associated with reduced tumorigenesis in breast tumors . QSOX1 reduces cell proliferation, decreases cell migration, promotes adhesion to the extracellular matrix, and reduces the activity of matrix metalloproteinases (MMP-2) . In vivo experiments have demonstrated that QSOX1 can drastically reduce tumor development .

  • Tumor-promoting effects: In contrast, QSOX1 is overexpressed in prostate cancers and pancreatic adenocarcinoma . Some studies have indicated that QSOX1 promotes invasion and proliferation of pancreatic and breast tumor cells in vitro, with QSOX1 mRNA serving as a predictive marker of poor survival in luminal B tumors .

Impact on Autophagy

Research indicates that QSOX1 plays a role in autophagy, a cellular process involved in the degradation and recycling of cellular components . QSOX1 inhibits autophagy by preventing the fusion of autophagosomes with lysosomes in breast cancer cells . During nutrient stress, QSOX1 expression is upregulated, enhancing cell survival by preventing excessive autophagy or autophagic cell death .

Influence on Cell Behavior

QSOX1 influences various aspects of cell behavior, particularly in the context of cancer . Suppression of QSOX1 protein slows cell proliferation and inhibits the invasion of breast tumor cells . The addition of recombinant QSOX1 can rescue this inhibition of invasion, underscoring its direct role in this process . QSOX1 also plays a role in the function of MMP-9, a key mediator of breast cancer invasive behavior .

Involvement in Oxidative Folding

QSOX1 functions as a chaperone and oxidase during oxidative folding, which is essential for the proper maturation of proteins . It facilitates the formation of disulfide bonds in proteins, contributing to their stability and biological activity .

QSOX1 and Cellular Stress

QSOX1 expression is induced by oxidative or endoplasmic reticulum (ER) stress, protecting cells from stress-induced cell death . It maintains cellular homeostasis during nutrient stress-induced autophagy and prevents autophagic cell death, allowing cells to survive by inhibiting the catabolic process .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
QSOX1; QSCN6; UNQ2520/PRO6013; Sulfhydryl oxidase 1; hQSOX; Quiescin Q6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-747
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
QSOX1
Target Protein Sequence
APRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWKALAEDVKA WRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRER LIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLGREVALDLSQ HKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTAYLQRLSGL TREAAQTTVAPTTANKIAPTVWKLADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVA LKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVN WIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGC RDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELC SACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAAAPELAMGAL ELESRNSTLDPGKPEMMKSPTNTTPHVPAEGPEASRPPKLHPGLRAAPGQEPPEHMAELQ RNEQEQPLGQWHLSKRDTGAALLAESRAEKNRLWGPLEVRRVGRSSKQLVDIPEGQLEAR AGRGRGQWLQVLGGGFSYLDISLCVGLYSLSFMGLLAMYTYFQAKIRALKGHAGHPAA
Uniprot No.

Target Background

Function
Quiescin sulfhydryl oxidase 1 (QSOX1) catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides, simultaneously reducing oxygen to hydrogen peroxide. It plays a crucial role in disulfide bond formation within various extracellular proteins. In fibroblasts, QSOX1 is essential for the proper incorporation of laminin into the extracellular matrix, thereby contributing to normal cell-cell adhesion and cell migration.
Gene References Into Functions
  1. This study highlights the impact of glycosylation on Golgi exit, furthering our understanding of late secretory sorting and quality control. PMID: 29757379
  2. High QSOX1 expression correlates with increased tumor invasiveness. PMID: 29804717
  3. Elevated QSOX1 expression is a significant independent predictor of reduced survival in breast cancer, potentially serving as a biomarker for aggressive disease and a therapeutic target. PMID: 27562495
  4. Ebselen has been identified as an in vitro inhibitor of QSOX1 enzymatic activity. PMID: 26158899
  5. QSOX1 immunoexpression has been observed in both non-neoplastic cerebellum and medulloblastoma samples. PMID: 25908093
  6. High QSOX1 RNA expression levels are associated with breast cancer. PMID: 23536962
  7. Studies suggest QSOX1 as a predictive biomarker for luminal cancers, potentially valuable for targeting elusive luminal B disease. PMID: 23680167
  8. QSOX1 shows promise as an important factor in cancer detection and prognosis. Elucidating its mechanisms of action in tumors and in vivo models will provide crucial insights for targeted anti-neoplastic therapies. PMID: 24359107
  9. Kinetic analysis of QSOX1 interaction with cysteine and glutathione at low micromolar concentrations suggests limited contribution to the oxidation of these monothiols in plasma. PMID: 24468475
  10. QSOX1 may be involved in neuroblastoma differentiation and regression, potentially serving as a biomarker for risk stratification. PMID: 24704990
  11. QSOX1 is induced by hypoxic stimuli and is a direct target of HIF-1. PMID: 24008827
  12. The QSOX1A isoenzyme is secreted from mammalian cells despite possessing a transmembrane domain; it undergoes cleavage at internal sites within the Golgi apparatus, yielding a soluble enzyme that dimerizes upon C-terminal domain cleavage. PMID: 23713614
  13. QSOX1 is a potential prognostic marker useful in breast tumor staging and patient stratification. PMID: 23460839
  14. QSOX1 activity is necessary for laminin incorporation into the fibroblast-synthesized extracellular matrix (ECM); ECM lacking QSOX1 shows impaired cell-matrix adhesion. PMID: 23704371
  15. Crystal structure analysis. PMID: 22801504
  16. These findings suggest potential roles for QSOX1 in atherosclerosis. PMID: 22069028
  17. QSOX1-mediated tumor cell invasion appears to occur via activation of MMP-2 and MMP-9. PMID: 21989104
  18. The C449-C452 motif is crucial for human QSOX1b activity; the C70-C73 motif is essential for electron transfer from thiol-containing substrates, including reduced proteins, DTT, and GSH. PMID: 21148546
  19. A partial QSOX1 crystal structure reveals a single-chain pseudo-dimer mimicking the quaternary structure of Erv enzymes. PMID: 20211621
  20. A prominent peptide derived from QSOX1 was identified in the plasma peptidome of ductal adenocarcinoma of the pancreas (DAP) patients. This peptide was detected in a significant proportion of DAP and IPMN patients. PMID: 19795908
  21. The longer human QSOX1 protein (hQSOX1a) is a transmembrane protein primarily localized to the Golgi apparatus and functions as an oxidase in vivo. PMID: 17331072
  22. Studies on internal redox steps using mutagenesis. PMID: 18393449
Database Links

HGNC: 9756

OMIM: 603120

KEGG: hsa:5768

STRING: 9606.ENSP00000356574

UniGene: Hs.744925

Protein Families
Quiescin-sulfhydryl oxidase (QSOX) family
Subcellular Location
[Isoform 1]: Golgi apparatus membrane; Single-pass membrane protein. Secreted.; [Isoform 2]: Secreted.
Tissue Specificity
Expressed in heart, placenta, lung, liver, skeletal muscle, pancreas and very weakly in brain and kidney.

Q&A

What is the structural organization and primary function of Recombinant Human QSOX1?

QSOX1 is an enzyme responsible for oxidizing thiols during protein folding while reducing molecular oxygen to hydrogen peroxide. Structurally, QSOX1 is an ancient gene fusion from thioredoxin (TRX) and ERV1 (a yeast sulfhydryl oxidase) located on chromosome 1q24 . The protein contains a PDI-like oxidoreductase region with thioredoxin domains at the N-terminus, while the C-terminus houses the FAD-binding region, where the isoalloxazine ring in FAD binds to QSOX1 sandwiched between α3 and α4 helices . This arrangement is critical for QSOX1's unique capability of both disulfide-generating and disulfide-transferring functions. The CxxC sequence motifs in both the TRX domain and ERV1 domain are essential for disulfide shuttling during catalysis .

How are the QSOX1 isoforms structured and what are their cellular locations?

QSOX1 exists in two main splice variants: QSOX1-S (short) and QSOX1-L (long). Both isoforms share identical sequences until the middle of the 12th exon, where the short form splices out 733 base pairs, resulting in a 604 amino acid protein without a transmembrane region . The long form is a 747-amino-acid protein that includes most of exon 12, including the transmembrane region .

Regarding cellular localization, QSOX1 contains a signal sequence suggesting secretion but lacks a KDEL endoplasmic reticulum-retention sequence . Despite this, QSOX1 has been found localized in the endoplasmic reticulum (ER) and more recently in the Golgi apparatus . In human embryonic fibroblasts, QSOX1 has been specifically localized to both the Golgi apparatus and endoplasmic reticulum, where it functions independently and in conjunction with protein disulfide isomerase to assist in folding nascent proteins .

What methodologies are recommended for QSOX1 detection and quantification?

For QSOX1 detection and quantification, multiple complementary approaches are recommended:

  • RNA expression analysis: Quantitative RT-PCR can be used to measure QSOX1 mRNA levels, as demonstrated in studies examining QSOX1 expression in invasive ductal carcinomas . RNA sequencing and microarray data have also been valuable, such as the Affymetrix gene expression data from 1881 molecularly typed cases of breast cancer used in the GOBO (Gene expression-based Outcome for Breast cancer Online) database .

  • Protein detection: Immunohistochemistry (IHC) is effective for examining QSOX1 protein expression in tumor tissues, allowing correlation with clinical parameters such as tumor grade and markers like Ki-67 . Western blotting can be used to detect QSOX1 in cell lines and tissue lysates, with appropriate controls to distinguish between the short and long isoforms .

  • Functional assays: Enzymatic activity can be measured using thiol-containing substrates, with QSOX1 showing high efficiency (Km=110–330 μM/thiol) and preference for protein substrates rather than small mono- and di-thiol containing molecules .

What mechanisms explain QSOX1's role in cancer progression and invasion?

QSOX1 contributes to cancer progression through several interconnected mechanisms:

  • Regulation of matrix metalloproteinases: QSOX1 affects the proteolytic activity of matrix metalloproteins (MMP-2 and -9) secreted by tumor cells . Silencing QSOX1 decreased MMP proteolytic activity, but not MMP mRNA in both pancreatic and breast tumor cell lines . This is particularly significant as MMP-9 is a key mediator of breast cancer invasive behavior .

  • Enhancement of cell invasion: Studies have demonstrated that suppression of QSOX1 protein dramatically inhibits breast tumor cells (MCF7, BT474, and BT549) from invading through Matrigel in modified Boyden chamber assays . Importantly, this inhibition of invasion could be rescued by the exogenous addition of recombinant QSOX1 protein, confirming QSOX1's direct role in the invasive phenotype .

  • Impact on tumor microenvironment: QSOX1 is believed to facilitate tumor cell migration at the tumor-stroma interface . This suggests that QSOX1 influences not only cancer cells themselves but also their interactions with surrounding tissues.

  • Cell proliferation effects: Tumor cells in which QSOX1 was silenced grew at less than 30% the rate of controls, indicating a role in regulating proliferation .

How does QSOX1 contribute to cancer stem cell dormancy and immune evasion?

Recent research has revealed QSOX1's crucial role in cancer stem cell dormancy and immune evasion mechanisms:

  • Creation of oxidative niche: Quiescent fibroblast-derived QSOX1 contributes to shaping an oxidative niche that facilitates dormant cancer stem cells (DCSCs) to evade immune elimination . This oxidative environment appears to be advantageous for tumor cells at various stages of tumorigenesis .

  • Upregulation of PD-L1 signaling: DCSCs can escape immune elimination by enhancing PD-L1 signaling, thereby maintaining immune equilibrium . QSOX1 promotes the expression of PD-L1 by elevating the level of reactive oxygen species .

  • T cell exclusion: High QSOX1 in the dormant tumor niche contributes to the exclusion of CD8+ T cells, further aiding immune evasion . This mechanism is particularly significant as CD8+ T cells normally restrict the outgrowth of tumor mass .

  • Impact on immunotherapy response: Clinically, high expression of QSOX1 predicts a poor response to anti-PD-1 treatment in patients with esophageal cancer . This finding highlights QSOX1's role as a potential predictive biomarker for immunotherapy efficacy.

What are the current controversies in QSOX1 cancer research?

There are notable controversies in the literature regarding QSOX1's role in cancer:

  • Prognostic indicator debate: While several studies suggest QSOX1 overexpression indicates poor prognosis, there is significant controversy regarding QSOX1 as a marker of poor versus favorable outcome in breast cancer . This discrepancy requires further investigation to determine the exact prognostic value of QSOX1 across different cancer types and subtypes.

  • Conflicting functional studies: Contradictory findings have been reported regarding QSOX1's effects on cancer cell behavior. While Katchman et al. demonstrated that silencing QSOX1 inhibited growth and invasion, Pernodet et al. reported opposite results, suggesting that silencing QSOX1 enhances growth in vivo and invasion in vitro of MB-231 breast carcinoma . These contradictory findings have been difficult to reconcile, with some suggesting methodological issues such as lack of certified cell lines might explain the disparities .

  • Cancer type specificity: The advantage QSOX1 provides to different cancer types remains incompletely understood . It remains critical to determine which tumor types overexpress QSOX1 and how they utilize its enzymatic activity to their advantage .

How can QSOX1 be targeted therapeutically in cancer treatment?

Emerging research suggests several promising approaches for targeting QSOX1 therapeutically:

  • Combination therapy approach: Blocking QSOX1 with Ebselen in combination with anti-PD-1 immunotherapy and chemotherapy can effectively eradicate residual dormant cancer stem cells by reducing PD-L1 expression and promoting CD8+ T cell infiltration . This multi-modal approach addresses both the immune evasion mechanisms and the intrinsic resistance of dormant cancer cells.

  • Targeting enzymatic activity: Since QSOX1's enzymatic function appears crucial for its role in cancer, developing specific inhibitors of its sulfhydryl oxidase activity may provide therapeutic benefits . Understanding the structural basis of QSOX1's activity, particularly the disulfide relay mechanisms, could inform more targeted inhibitor design.

  • Anti-metastatic applications: Given QSOX1's involvement in tumor cell invasion and migration at the tumor-stroma interface, targeting QSOX1 could potentially inhibit metastatic spread . This approach might be particularly valuable in aggressive cancer types with high metastatic potential.

  • Biomarker-guided therapy selection: QSOX1 expression levels might serve as a biomarker to guide therapy selection, particularly for immunotherapies targeting the PD-1/PD-L1 axis . Patients with high QSOX1 expression might benefit from combination approaches that include QSOX1 inhibition.

What experimental designs best reveal QSOX1's functional impact on cancer cells?

To effectively study QSOX1's functional impact on cancer cells, consider these methodological approaches:

  • Gene silencing experiments: Using short hairpin RNA in lentiviral vectors to stably knock down QSOX1 in tumor cell lines has proven effective for studying its role in proliferation and invasion . This approach allows for long-term examination of phenotypic changes resulting from QSOX1 suppression.

  • Invasion assays: Modified Boyden chamber assays with Matrigel basement membrane have successfully demonstrated QSOX1's critical role in cancer cell invasion . These should be coupled with rescue experiments using recombinant QSOX1 protein to confirm specificity.

  • Zymography techniques: Gelatin zymography has been valuable in demonstrating QSOX1's impact on MMP activity . This technique allows visualization of the functional consequences of QSOX1 manipulation on extracellular matrix degradation.

  • In vivo models: Animal models exploring QSOX1's role in tumor establishment, growth, and metastasis provide crucial insights that complement in vitro findings . These models are particularly important for validating therapeutic approaches targeting QSOX1.

  • Co-culture systems: Given QSOX1's role at the tumor-stroma interface, co-culture systems incorporating cancer cells with fibroblasts or immune cells can reveal important aspects of QSOX1's function in the tumor microenvironment .

How should recombinant QSOX1 be handled for optimal experimental outcomes?

When working with recombinant human QSOX1 protein:

  • Storage considerations: As with most recombinant proteins, QSOX1 should be stored at -80°C for long-term storage, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise enzymatic activity .

  • Activity verification: Prior to experimental use, it's advisable to verify enzymatic activity using standard sulfhydryl oxidase assays with appropriate substrates . QSOX1 has been shown to efficiently introduce disulfide bonds into proteins (Km=110–330 μM/thiol) and prefers protein substrates rather than small mono- and di-thiol containing molecules .

  • Experimental concentrations: When using recombinant QSOX1 for rescue experiments in invasion assays, carefully titrate the concentration to determine the optimal amount needed to restore phenotypes in QSOX1-silenced cells .

  • Buffer considerations: The protein's enzymatic activity is FAD-dependent, so experimental buffers should maintain conditions that preserve the interaction between QSOX1 and its FAD cofactor .

  • Avoiding contaminants: When studying QSOX1's effects on oxidative environments, ensure experimental conditions are free from other oxidizing agents that might confound results .

What are the most promising areas for future QSOX1 research?

Several key areas warrant further investigation:

  • Mechanism of action in different tumor types: More studies are required to reveal what advantage QSOX1 provides to breast and other types of cancer . Understanding which tumor types overexpress QSOX1 and how they utilize its enzymatic activity could lead to more targeted therapeutic approaches.

  • Resolving contradictory findings: Additional research is needed to clarify the contradictory findings regarding QSOX1's role in cancer cell growth and invasion . Well-controlled studies using validated cell lines and consistent methodologies are essential.

  • Defining mechanisms within the tumor microenvironment: As interest increases in understanding tumorigenesis within the extracellular matrix and how tumor cells influence fibroblasts and other stromal cells, QSOX1's role in these interactions requires further exploration .

  • Development of specific inhibitors: Identifying or developing small molecule inhibitors specific to QSOX1 could provide valuable research tools and potential therapeutic agents .

  • Validating combination therapy approaches: Further validation of the promising combination of QSOX1 inhibition with immunotherapy and chemotherapy in various cancer types could lead to new clinical strategies for eradicating dormant cancer stem cells and preventing recurrence .

How can QSOX1 research be translated into clinical applications?

Translating QSOX1 research into clinical applications involves several considerations:

  • Biomarker development: QSOX1 expression may serve as a prognostic indicator of metastatic potential or even indicate that cancer is present in a host . Further validation of QSOX1 as a biomarker could lead to clinical tests for cancer detection, prognosis, and therapy selection.

  • Therapeutic targeting: Defining the mechanism(s) of QSOX1 activity in tumors and in in vivo models will provide important insights into how to target QSOX1 with anti-neoplastic agents . This could lead to the development of novel treatments, particularly for cancers with poor prognosis.

  • Immunotherapy enhancement: Given QSOX1's role in immune evasion through PD-L1 upregulation and T cell exclusion, targeting QSOX1 could enhance the efficacy of existing immunotherapies . This approach might be particularly valuable for patients who currently respond poorly to immunotherapy.

  • Prevention of recurrence: QSOX1 inhibition in combination with other therapies shows promise for eradicating dormant cancer stem cells . This strategy could potentially address one of the most challenging aspects of cancer treatment: preventing late recurrence after apparently successful initial therapy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.