Recombinant Human SUN domain-containing protein 2 (SUN2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SUN2; FRIGG; KIAA0668; RAB5IP; UNC84B; SUN domain-containing protein 2; Protein unc-84 homolog B; Rab5-interacting protein; Rab5IP; Sad1/unc-84 protein-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-717
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSRRSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRLSPAPQLG PSSDAHTSYYSESLVHESWFPPRSSLEELHGDANWGEDLRVRRRRGTGGSESSRASGLVG RKATEDFLGSSSGYSSEDDYVGYSDVDQQSSSSRLRSAVSRAGSLLWMVATSPGRLFRLL YWWAGTTWYRLTTAASLLDVFVLTRRFSSLKTFLWFLLPLLLLTCLTYGAWYFYPYGLQT FHPALVSWWAAKDSRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQK EAMRLERLELRQGAPGQGGGGGLSHEDTLALLEGLVSRREAALKEDFRRETAARIQEELS ALRAEHQQDSEDLFKKIVRASQESEARIQQLKSEWQSMTQESFQESSVKELRRLEDQLAG LQQELAALALKQSSVAEEVGLLPQQIQAVRDDVESQFPAWISQFLARGGGGRVGLLQREE MQAQLRELESKILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYS EDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGN CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGT LLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH
Uniprot No.

Target Background

Function

SUN domain-containing protein 2 (SUN2) is a component of the LINC (Linker of Nucleoskeleton and Cytoskeleton) complex, crucial for connecting the nuclear lamina and cytoskeleton. The LINC complex facilitates nucleocytoplasmic interactions, playing a vital role in transmitting mechanical forces across the nuclear envelope and regulating nuclear movement and positioning. Specifically, SUN2, along with SYNE2, forms transmembrane actin-associated nuclear (TAN) lines, which bind to F-actin cables, coupling the nucleus to retrograde actin flow during actin-dependent nuclear movement. SUN2 is essential for interkinetic nuclear migration (INM) and nucleokinesis, and is crucial for centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and glial migration. It's also involved in nuclear migration in retinal photoreceptor progenitors, associating with cytoplasmic dynein-dynactin and kinesin motor complexes, and likely B-type lamins; SUN1 and SUN2 appear to exhibit functional redundancy. The SUN1/2:KASH5 LINC complex links telomeres to microtubules during meiosis, with SUN1 and SUN2 showing at least partial redundancy. SUN2 anchors chromosome movement in meiotic prophase and participates in selective gene expression of coding and non-coding RNAs essential for gametogenesis. It is required for telomere attachment to the nuclear envelope and gametogenesis. Additionally, SUN2 may function on endocytic vesicles as a RAB5-GDP receptor, potentially participating in RAB5 activation.

Gene References Into Functions
  1. SUN2 is essential for optimal activation and proliferation of primary CD4 T cells; its disruption contributes to HIV infection in primary lymphocytes. (PMID: 28077629)
  2. SUN2 functions as a tumor suppressor by inhibiting the Warburg effect in lung cancer. (PMID: 26658802)
  3. SUN2 overexpression disrupts nuclear shape and early HIV infection events. (PMID: 26865710)
  4. SUN2, acting as a tumor suppressor, mediates miR-221 and miR-222 functions in central nervous system embryonal tumors. (PMID: 24832085)
  5. Crystal structure of the SUN2 protein SUN domain is available. (PMID: 22170055)
  6. Lamin A, but not lamin C, partially restores SUN2's nuclear envelope localization. (PMID: 21655223)
  7. SUN2 is the first mammalian inner nuclear membrane (INM) protein using a nuclear localization signal, a Golgi retrieval signal, and a perinuclear domain for INM targeting. (PMID: 20551905)
Database Links

HGNC: 14210

OMIM: 613569

KEGG: hsa:25777

STRING: 9606.ENSP00000385616

UniGene: Hs.517622

Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein. Nucleus envelope. Endosome membrane; Single-pass type II membrane protein.
Tissue Specificity
Widely expressed. Highly expressed in heart, lung and muscle. Weakly expressed in fetal heart. Slightly overexpressed in some heart tissues form patients with congenital heart defects.

Q&A

What is SUN2 and what is its cellular localization?

SUN2 is a mammalian inner nuclear membrane protein that forms part of the LINC complex, which connects the nuclear lamina to the cytoskeleton . It is an 85-kDa protein that is partially insoluble in detergent with high salt concentration and chaotropic agents, and is enriched in purified nuclei .

Electron microscopy analysis has demonstrated that SUN2 predominantly localizes to the nuclear envelope, with sub-populations present in small clusters . Importantly, the SUN domain of SUN2 is specifically localized to the periplasmic space between the inner and outer nuclear membranes . This strategic positioning allows SUN2 to serve as a bridge between intranuclear and cytoplasmic structures.

While SUN2 is primarily associated with the nuclear envelope, it can also be found in punctate structures within the cytoplasm that resemble vesicles in certain cell types or under specific conditions . This alternative localization has been observed in immunofluorescence studies and appears to be regulated by multiple factors, including interactions with Rab5, a key regulator of early endocytosis .

How does SUN2 contribute to nuclear envelope architecture?

SUN2 is a key architectural component of the nuclear envelope that contributes to its structure and function through multiple mechanisms:

First, SUN2 serves as an essential component of the LINC complex by spanning the inner nuclear membrane and interacting with KASH domain-containing proteins in the outer nuclear membrane . This connection creates a mechanical bridge across the nuclear envelope that maintains proper nuclear architecture and spacing between the inner and outer nuclear membranes.

Second, the N-terminal domain of SUN2 interacts with nuclear lamins, particularly lamin A/C, which is critical for maintaining proper nuclear morphology . Studies using lamin A/C knockout (Lmna -/-) cells demonstrate that SUN2 localization becomes aberrant, with redistribution to the cytoplasm and irregularly shaped nuclei . This connection between SUN2 and the nuclear lamina helps maintain nuclear integrity and shape.

Third, research has shown that SUN2 responds to mechanical forces applied to the nucleus, which regulates gene expression in mechanosensitive regions of the genome . When cells experience different levels of actomyosin contractility, SUN2 can be redistributed between the nuclear envelope and the endoplasmic reticulum . Under high actomyosin contractility, SUN2 is almost completely relocated from the ER to the nuclear envelope, whereas under low contractility, it becomes more enriched in the ER .

Finally, SUN2 plays a role in organizing perinuclear heterochromatin . In SUN2-deficient cells, the distribution of H3K9me3 (a marker of constitutive heterochromatin) changes from a perinuclear enriched pattern to an even distribution throughout the nucleus . This indicates that SUN2 is essential for maintaining proper chromatin organization at the nuclear periphery.

What are the key differences between SUN1 and SUN2 proteins?

Though SUN1 and SUN2 share structural similarities and both contribute to LINC complex formation, they exhibit several important differences in localization, function, and tissue-specific roles:

FeatureSUN1SUN2
Gene originDerived from different gene than SUN2Derived from different gene than SUN1
Distribution pattern during meiosisNot specifically documented in search resultsRedistributes from homogeneous distribution to distinct dots at telomere attachment sites
Response to Lamin A/C deficiencyNot specifically documented in search resultsAberrant distribution in Lmna -/- cells with cytoplasmic mislocalization
Interaction with Rab5Not specifically documented in search resultsInteracts with GTP-bound Rab5 and can relocate to endosomes
Meiotic functionNot specifically documented in search resultsLocated at attachment sites of meiotic chromosomes; connects telomeres to nuclear envelope
Response to mechanical forceNot specifically documented in search resultsDistribution between ER and NE is regulated by actomyosin contractility

These differences suggest that while both proteins contribute to nuclear envelope architecture, they likely have specialized and complementary functions, with SUN2 playing particularly important roles in meiosis and mechanotransduction.

How is SUN2 expression and localization regulated?

SUN2 localization and dynamics are regulated through multiple mechanisms:

Lamin A/C regulation: SUN2 localization is strongly dependent on Lamin A/C. In embryonic fibroblasts derived from Lmna knockout mice, SUN2 shows aberrant distribution in the cytoplasm and around irregularly shaped nuclei, rather than the normal rim-like shape around the nucleus observed in wild-type cells . This mislocalization can be rescued by expressing EGFP-Lamin A in the Lmna -/- cells, demonstrating that Lamin A specifically regulates SUN2 positioning .

Rab5 interaction: SUN2 can interact with Rab5, a key regulator of early endocytosis. Upon overexpression of Rab5 or its GTPase-deficient mutant Rab5 Q79L, endogenous SUN2 is redistributed to enlarged early endosomes . This interaction has been confirmed by immunoprecipitation and FRET analysis, suggesting that SUN2 may act as a Rab5 effector via direct interaction with the GTP-bound form of Rab5 .

Actomyosin contractility: Mechanical forces generated by actomyosin contractility regulate the distribution of SUN2 between the nuclear envelope and endoplasmic reticulum. Under high levels of actomyosin contractility, SUN2 is almost completely relocated from the ER to the nuclear envelope, while suppression of actomyosin contractility results in greater enrichment of SUN2 at the ER .

Domain-dependent localization: The proper localization of SUN2 to the inner nuclear membrane depends on multiple targeting elements. These include a classical nuclear localization signal (cNLS) in the N-terminal nucleoplasmic domain, a cluster of arginines (4R motif) that serves as a coatomer-mediated retrieval signal from the Golgi, and unexpectedly, the C-terminal lumenal SUN domain . When any of these elements are disrupted, SUN2 localization is compromised.

Understanding these regulatory mechanisms is crucial for researchers investigating SUN2 function in different cellular contexts and for designing experiments to manipulate SUN2 localization.

What methodologies are most effective for studying SUN2 dynamics in living cells?

Several advanced imaging and biochemical techniques have proven effective for investigating SUN2 dynamics in living cells:

Single-molecule tracking: This approach allows direct visualization of individual SUN2 molecules to analyze their mobility and spatial relationships with other cellular structures like actin bundles . By tagging SUN2 with fluorescent proteins or organic dyes compatible with single-molecule detection (like Halotag JF-650), researchers can track the trajectories of individual SUN2 molecules and determine their diffusion properties. Analysis of mean squared displacement (MSD) can reveal whether SUN2 molecules are mobile or constrained, and their anomalous diffusion exponent (α) values can be calculated to characterize their movement patterns .

Dual-color single-molecule imaging: By simultaneously imaging SUN2 and other cellular structures (such as actin bundles labeled with Lifeact-EGFP), researchers can directly examine the spatial correlation between SUN2 localization and cytoskeletal elements . This approach has revealed that constrained SUN2 molecules often colocalize with actin bundles near the nuclear envelope, with approximately 70% of constrained SUN2 molecules being spatially correlated with actin bundles under various actomyosin contractility conditions .

Förster Resonance Energy Transfer (FRET): FRET analysis can confirm direct interactions between SUN2 and its binding partners, such as Rab5 . This technique can demonstrate close proximity (<10 Å) between proteins in living cells and has been used to verify the direct interaction between SUN2 and the GTP-bound form of Rab5 .

Super-resolution microscopy: Techniques like Structured Illumination Microscopy (SIM) and Stochastic Optical Reconstruction Microscopy (STORM) provide higher spatial resolution than conventional fluorescence microscopy and can reveal the detailed organization of SUN2 at the nuclear envelope . These methods can help visualize SUN2 clusters and their relationship with other nuclear envelope components.

Immunofluorescence with differential detergent permeabilization: This approach can distinguish between SUN2 localized to the inner nuclear membrane versus other cellular compartments. By selectively permeabilizing the plasma membrane with digitonin or the nuclear envelope with Triton X-100/SDS, researchers can determine whether SUN2 constructs have successfully reached the INM .

These methodologies, often used in combination, provide comprehensive insights into SUN2 dynamics and interactions in living cells.

How does mechanical force influence SUN2 distribution and function?

Mechanical forces play a crucial role in regulating SUN2 distribution and function, highlighting its role in nuclear mechanotransduction:

Redistribution between ER and NE: Under high levels of actomyosin contractility, SUN2 is almost completely relocated from the endoplasmic reticulum to the nuclear envelope. Conversely, when actomyosin contractility is suppressed, SUN2 becomes more enriched at the ER . This dynamic redistribution allows cells to respond to changes in mechanical environment by modulating the connection between the nucleus and cytoskeleton.

Mobility changes: Single-molecule tracking experiments have revealed that the mobility of SUN2 is directly influenced by actomyosin contractility. Under high contractility conditions, a larger proportion of SUN2 molecules become constrained (less mobile), while under low contractility conditions, more SUN2 molecules are mobile . These mobility changes are associated with the interaction between SUN2 and actin bundles near the nuclear envelope.

Regulation of gene expression: The mechanical response of SUN2 to actomyosin contractility has been found to regulate the expression of mechanosensitive genes located in lamina-associated domains (LADs) and perinuclear heterochromatin . When SUN2 is deficient or its connections with actin cytoskeleton or nuclear lamina are disrupted, there are significant changes in gene expression, particularly affecting genes located in LAD regions .

Chromatin organization effects: SUN2 is essential for maintaining the perinuclear enrichment of constitutive heterochromatin marked by H3K9me3. In SUN2-deficient cells, this heterochromatin marker changes from a perinuclear enriched pattern to an even distribution throughout the nucleus . This reorganization of chromatin may contribute to the changes in gene expression observed in response to mechanical stimuli.

Experimental approaches for studying mechanical effects on SUN2:

  • Modulation of actomyosin contractility using pharmacological agents (e.g., blebbistatin to decrease contractility or calyculin A to increase it)

  • Single-molecule tracking to quantify changes in SUN2 mobility

  • Immunofluorescence to visualize redistribution between cellular compartments

  • RNA-seq to assess changes in gene expression in response to altered SUN2 function

These findings highlight the importance of SUN2 as a mechanosensitive component of the nuclear envelope that translates physical forces into cellular responses.

What are the challenges in purifying recombinant SUN2 for structural studies?

Purifying recombinant SUN2 for structural studies presents several technical challenges that researchers must address:

Solubility limitations: SUN2 is partially insoluble in detergent with high salt concentration and in chaotropic agents . This inherent insolubility makes it difficult to extract and maintain the protein in solution during purification processes. Biochemical analyses have shown that SUN2 has properties that make it resistant to standard solubilization approaches used for membrane proteins.

Membrane protein complexities: As an integral membrane protein that spans the inner nuclear membrane, SUN2 contains hydrophobic transmembrane domains that are challenging to maintain in their native conformation outside of a lipid bilayer. Researchers often need to use specialized detergents or lipid nanodiscs to stabilize these domains during purification and subsequent structural analyses.

Domain-specific purification strategies: Different domains of SUN2 may require different expression and purification approaches. For example:

  • The SUN domain (C-terminal, lumenal) is more amenable to soluble expression and has been successfully used in structural studies

  • The N-terminal, nucleoplasmic domain contains disordered regions that may complicate structural analysis

  • The transmembrane region presents typical challenges associated with membrane-spanning segments

Expression system selection: The expression system must be carefully chosen to ensure proper folding and post-translational modifications of SUN2. While bacterial expression systems like E. coli are simpler and higher-yielding, they may not provide the environment needed for correct folding of mammalian nuclear envelope proteins. Eukaryotic expression systems like insect cells or wheat germ cell-free systems (as used in ) might be more appropriate but generally provide lower yields.

Protein quality assessment: Ensuring that purified SUN2 retains its native structure and function is essential for meaningful structural studies. Researchers should incorporate functional assays to verify that recombinant SUN2 can still interact with known binding partners like KASH domain proteins or Lamin A/C.

How can researchers study SUN2's role in nuclear mechanotransduction pathways?

Investigating SUN2's function in nuclear mechanotransduction requires multiple experimental approaches:

Gene knockout and mutation studies: Generating SUN2 knockout cells or expressing truncation mutants lacking specific domains can reveal how SUN2 contributes to mechanotransduction. For example, expressing SUN2 constructs lacking either the N-terminal domain (which interacts with lamina) or the SUN domain (which interacts with KASH proteins) can help determine how each connection contributes to force transmission .

Single-molecule biophysical approaches: Techniques like single-molecule tracking can provide direct visualization of how SUN2 responds to mechanical stimuli. By analyzing the diffusion properties of individual SUN2 molecules under different mechanical conditions, researchers can determine how forces affect SUN2 mobility and distribution .

Chromatin organization analysis: SUN2 deficiency leads to changes in heterochromatin organization, particularly affecting the perinuclear enrichment of H3K9me3 . Researchers can use immunofluorescence microscopy to visualize changes in heterochromatin markers or advanced techniques like ChIP-seq to map changes in chromatin modifications genome-wide when SUN2 function is perturbed.

Transcriptional profiling: RNA-seq analysis of cells with altered SUN2 function or under different mechanical conditions can reveal how SUN2-dependent mechanotransduction affects gene expression . This approach has shown that genes affected by SUN2 deficiency are enriched within lamina-associated domains (LADs), confirming SUN2's role in regulating nuclear periphery-associated genes .

Force application techniques: Researchers can apply controlled mechanical forces to cells using:

  • Micropipette aspiration of nuclei

  • Magnetic tweezers to pull on magnetically labeled cytoskeletal components

  • Substrate stretching to induce cell-wide tension

  • Atomic force microscopy to apply localized forces

While observing SUN2 localization and dynamics, these approaches can provide insights into how mechanical forces are transmitted through the LINC complex.

Computational modeling: Molecular dynamics simulations can model how SUN2 responds to mechanical forces at the atomic level . These simulations can predict conformational changes in SUN2 structure under tension and guide experimental designs to test specific mechanistic hypotheses.

The combination of these approaches provides a comprehensive understanding of SUN2's role in nuclear mechanotransduction pathways.

What methodological approaches can differentiate between SUN1 and SUN2 functions?

Distinguishing the specific functions of SUN1 and SUN2 requires carefully designed experimental strategies:

Selective gene silencing/knockout: Generating single knockouts of either SUN1 or SUN2, as well as double knockouts, can reveal their unique and redundant functions. RNA interference (RNAi) or CRISPR-Cas9 gene editing can be employed to create these modified cell lines . Phenotypic comparisons between SUN1-deficient, SUN2-deficient, and double-deficient cells provide insights into their individual contributions to cellular processes.

Isoform-specific antibodies: Using highly specific antibodies that recognize either SUN1 or SUN2 allows visualization of their distinct localizations by immunofluorescence microscopy . For example, studies have shown that during meiosis, SUN2 exhibits a punctate distribution at telomere attachment sites, which differs from the distribution pattern of other inner nuclear membrane proteins .

Domain swapping experiments: Creating chimeric proteins where domains from SUN1 are swapped with corresponding domains from SUN2 can help identify which regions are responsible for their unique functions . For example, fusing the N-terminal domain of SUN2 (containing its NLS and 4R motif) to another SUN protein like SPAG4 can transfer SUN2's nuclear envelope targeting ability .

Rescue experiments: In cells lacking endogenous SUN1 or SUN2, reintroduction of wild-type or mutant versions can reveal which domains are necessary for specific functions . For instance, expressing EGFP-Lamin A in Lmna knockout cells restores the normal rim-like nuclear envelope localization of SUN2, demonstrating the dependency of SUN2 localization on Lamin A .

Context-specific studies: Examining SUN1 and SUN2 in specific cellular contexts where they might play distinct roles, such as during meiosis or in response to mechanical stress, can highlight their unique functions . For example, studying SUN2 in meiotic cells revealed its specific role in telomere attachment to the nuclear envelope during meiotic prophase I .

Specific interactome analysis: Identifying the unique binding partners of SUN1 versus SUN2 through techniques like proximity labeling (BioID), co-immunoprecipitation followed by mass spectrometry, or yeast two-hybrid screening can reveal their distinct interaction networks . These approaches have identified interactions specific to SUN2, such as its binding to Rab5 in endocytic pathways .

By combining these approaches, researchers can build a comprehensive understanding of the unique and overlapping functions of SUN1 and SUN2 in various cellular processes.

How can the dual localization of SUN2 at the nuclear envelope and in vesicular structures be experimentally investigated?

The unique ability of SUN2 to localize to both the nuclear envelope and vesicular structures presents an interesting research challenge that requires specific experimental approaches:

Live-cell imaging with fluorescently tagged SUN2: Expressing SUN2 fused to fluorescent proteins allows real-time visualization of its dynamic localization . Time-lapse imaging can capture the redistribution of SUN2 between the nuclear envelope and vesicular structures under different conditions, such as during Rab5 overexpression or changes in actomyosin contractility.

Co-localization with compartment markers: Dual labeling of SUN2 with markers for different cellular compartments can help identify the nature of the vesicular structures where SUN2 resides . Key markers include:

  • Rab5 for early endosomes

  • LAMP1 for lysosomes

  • Calreticulin or Sec61β for endoplasmic reticulum

  • GM130 for Golgi apparatus

Subcellular fractionation: Biochemical separation of cellular components followed by Western blotting can quantify the distribution of SUN2 across different compartments . This approach allows comparison of SUN2 levels in nuclear, membrane, and vesicular fractions under various experimental conditions.

Electron microscopy with immunogold labeling: This high-resolution imaging technique can precisely localize SUN2 within cellular ultrastructures . It has been used to demonstrate that SUN2 is concentrated at membrane-spanning fibrillar complexes that connect telomeres to the nuclear envelope during meiosis .

Pharmacological manipulation: Treating cells with compounds that affect vesicular trafficking or nuclear envelope dynamics can reveal mechanisms regulating SUN2 distribution . Examples include:

  • Brefeldin A to disrupt Golgi-ER trafficking

  • Nocodazole to depolymerize microtubules

  • Cytochalasin D to disrupt actin filaments

  • Blebbistatin or calyculin A to modulate actomyosin contractility

FRET analysis with compartment-specific proteins: This technique can confirm direct interactions between SUN2 and proteins in different cellular compartments, such as its interaction with Rab5 in endosomal structures . FRET signals indicate proximity (<10 Å) between the fluorescently labeled proteins.

Differential detergent extraction: Sequential extraction with digitonin (which permeabilizes only the plasma membrane) followed by Triton X-100/SDS (which permeabilizes the nuclear envelope) can distinguish between SUN2 populations in different membrane compartments .

These complementary approaches can provide comprehensive insights into the mechanisms regulating SUN2's dual localization and its functional significance in different cellular compartments.

What are the current challenges in visualizing SUN2-KASH interactions at the nuclear envelope?

Visualizing SUN2-KASH interactions at the nuclear envelope presents several technical challenges due to the complex nature of this protein interface:

Resolution limitations: The SUN2-KASH interaction occurs within the ~30-50 nm perinuclear space between the inner and outer nuclear membranes, which is below the resolution limit of conventional light microscopy (~200 nm) . While super-resolution techniques like STORM and PALM can achieve 10-20 nm resolution, capturing the dynamic interaction in living cells remains challenging.

Protein orientation complexity: The SUN2-KASH interaction involves the C-terminal SUN domain of SUN2 extending into the perinuclear space to interact with the KASH domain of nesprins embedded in the outer nuclear membrane . This three-dimensional arrangement within a confined space makes it difficult to visualize the interaction interface directly.

Transient interaction dynamics: The SUN2-KASH interaction may be dynamic and regulated by mechanical forces or other signaling events . Capturing these potentially transient interactions requires high temporal resolution imaging combined with high spatial resolution, which presents technical tradeoffs.

Antibody accessibility issues: The perinuclear space where SUN2-KASH interactions occur is not readily accessible to antibodies unless cells are extensively permeabilized, which can disrupt the native architecture of the nuclear envelope . This creates challenges for immunofluorescence-based visualization approaches.

Sample preparation artifacts: Fixation and permeabilization procedures required for many imaging techniques can potentially disrupt the delicate architecture of the nuclear envelope and alter the native state of SUN2-KASH interactions.

Current methodological approaches to overcome these challenges:

  • Proximity ligation assays (PLA): This technique can detect protein-protein interactions within 40 nm distance, suitable for visualizing SUN2-KASH interactions while providing spatial information about where these interactions occur.

  • Split fluorescent protein complementation: By tagging SUN2 and KASH proteins with complementary fragments of a fluorescent protein (e.g., split GFP), a fluorescent signal is generated only when the proteins interact, providing direct visualization of the interaction sites.

  • FRET-based sensors: Developing tension-sensitive FRET sensors incorporated into SUN2 or KASH proteins could reveal not only where interactions occur but also the mechanical forces experienced at these sites.

  • Cryo-electron tomography: This technique can provide nanometer-resolution 3D views of the nuclear envelope architecture and potentially visualize SUN2-KASH complexes in their native state, though sample preparation remains challenging.

  • Expansion microscopy: By physically expanding the sample, this technique can achieve effective super-resolution imaging on conventional microscopes and might help visualize the perinuclear space with improved clarity.

Overcoming these challenges will require continued development of innovative imaging approaches and careful experimental design to preserve the native state of the nuclear envelope.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.