Recombinant Human SUN domain-containing protein 3 (SUN3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
SUN3; SUNC1; SUN domain-containing protein 3; Sad1/unc-84 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SUN3
Target Protein Sequence
MSGKTKARRAAMFFRRCSEDASGSASGNALLSEDENPDANGVTRSWKIILSTMLTLTFLL VGLLNHQWLKETDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNF RQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVNYVLKKLRED QVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCW AFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL GQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVHGTPGKHI
Uniprot No.

Target Background

Function
Recombinant Human SUN domain-containing protein 3 (SUN3) is a likely component of the LINC (Linker of Nucleoskeleton and Cytoskeleton) complex, crucial for connecting the nuclear lamina and cytoskeleton. LINC complex-mediated nucleocytoplasmic interactions are vital for transmitting mechanical forces across the nuclear envelope and regulating nuclear movement and positioning. SUN3 may also participate in nuclear remodeling during spermatogenesis, specifically sperm head formation. A potential SUN3:SYNE1 LINC complex might anchor spermatid nuclei to posterior cytoskeletal structures like the manchette.
Gene References Into Functions
  1. Clinical trial on gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  2. Observational study and genome-wide association study on gene-disease association. (HuGE Navigator) PMID: 19193627
  3. cDNA from Macaca fascicularis was used to identify a novel human gene, SUNC1. PMID: 12498619
Database Links

HGNC: 22429

KEGG: hsa:256979

STRING: 9606.ENSP00000297325

UniGene: Hs.406741

Subcellular Location
Membrane; Single-pass membrane protein. Nucleus envelope. Nucleus inner membrane.

Q&A

What is SUN3 and what are its primary cellular functions?

SUN3 (Sad1 And UNC84 Domain Containing 3) is a protein-coding gene that functions as a component of the LINC complex. This complex establishes connections between the nuclear lamina and cytoskeleton, mediating mechanical force transmission across the nuclear envelope. SUN3 plays essential roles in nuclear movement and positioning within cells and is particularly important during spermatogenesis. As a probable component of the LINC complex, SUN3 helps establish nucleocytoplasmic interactions that facilitate mechanical force transmission across the nuclear envelope, contributing to precise nuclear positioning and movement .

To study SUN3's primary functions, researchers should employ a combination of techniques including immunofluorescence microscopy to visualize subcellular localization, co-immunoprecipitation to identify binding partners, and knockdown/knockout studies using siRNA or CRISPR-Cas9 to assess functional consequences of SUN3 depletion in relevant cell types, particularly in testicular tissue where SUN3 has specialized functions.

What is the structural organization of SUN3 protein?

SUN3 belongs to the SUN domain protein family, characterized by a conserved C-terminal SUN domain. Structural studies of SUN domains, exemplified by research on SUN2, reveal that the SUN domain forms homotrimers, which are critical for its function . The protein contains a transmembrane domain that anchors it to the nuclear envelope, with the SUN domain extending into the perinuclear space.

For structural studies of SUN3, researchers should consider:

  • X-ray crystallography or cryo-EM for high-resolution structure determination

  • Site-directed mutagenesis to identify functionally important residues

  • Limited proteolysis to define domain boundaries

  • Circular dichroism spectroscopy to assess secondary structure content

The trimerization capability of the SUN domain is particularly important for its function, as this oligomeric structure facilitates interactions with KASH domain-containing proteins to form the LINC complex .

How does SUN3 interact with other proteins in the nuclear envelope?

SUN3 primarily interacts with KASH domain-containing proteins such as SYNE1. The SUN domain of SUN3 extends into the perinuclear space, where it engages with the KASH domains of nesprins. This interaction creates a bridge across the nuclear envelope, connecting the nucleoskeleton to the cytoskeleton .

Methodological approaches to study these interactions include:

  • Proximity labeling techniques (BioID, APEX) to identify novel interaction partners

  • FRET (Fluorescence Resonance Energy Transfer) to assess direct protein-protein interactions in living cells

  • Split-GFP complementation assays to visualize interactions at the nuclear envelope

  • Co-immunoprecipitation followed by mass spectrometry to identify complexes

  • Yeast two-hybrid screening to detect binary interactions

In particular, the SUN3:SYNE1 LINC complex is thought to tether spermatid nuclei to posterior cytoskeletal structures such as the manchette during sperm head formation .

What experimental approaches are most effective for studying post-translational modifications of SUN3?

While specific post-translational modifications (PTMs) of human SUN3 are not well-characterized in the provided search results, studies on related SUN proteins such as Mps3 in yeast have shown that acetylation can regulate their function . Research on the C. elegans SUN-1 also revealed functionally important phosphorylation .

Methodological recommendations for studying SUN3 PTMs include:

  • Mass spectrometry-based approaches:

    • Enrichment strategies for specific PTMs (phosphopeptide enrichment with TiO2, immunoprecipitation with PTM-specific antibodies)

    • Quantitative proteomics using SILAC or TMT labeling to compare PTM levels under different conditions

    • Top-down proteomics to preserve intact proteoforms

  • Biochemical characterization:

    • In vitro acetylation/phosphorylation assays with candidate enzymes

    • Generation of PTM-specific antibodies for Western blotting and immunofluorescence

    • Site-directed mutagenesis of potential modification sites followed by functional assays

The acetylation of SUN proteins like Mps3 by Eco1 can regulate nuclear organization without affecting protein distribution in the nuclear membrane, suggesting that similar regulatory mechanisms might exist for human SUN3 .

How can researchers effectively investigate SUN3's role in nuclear dynamics during spermatogenesis?

SUN3 is implicated in nuclear remodeling during sperm head formation in spermatogenesis, where it likely tethers spermatid nuclei to posterior cytoskeletal structures such as the manchette . To study this specialized function:

  • Tissue-specific approaches:

    • Immunohistochemistry on testicular sections to track SUN3 localization during spermatogenesis stages

    • Laser-capture microdissection to isolate specific cell populations for molecular analysis

    • Single-cell RNA-seq to characterize expression patterns in different spermatogenic cell types

  • Live imaging strategies:

    • CRISPR-Cas9 knock-in of fluorescent tags to visualize endogenous SUN3 dynamics

    • Multi-color imaging to simultaneously track SUN3 and interaction partners

    • Light-sheet microscopy for long-term imaging with reduced phototoxicity

    • Super-resolution techniques (STED, PALM/STORM) to visualize nanoscale organization

  • Functional interrogation:

    • Conditional knockout models specific to male germ cells

    • Rescue experiments with wild-type and mutant SUN3 constructs

    • Electron microscopy to assess ultrastructural abnormalities in nuclear envelope architecture

The complex architecture of the manchette and nuclear envelope during spermiogenesis requires specialized imaging and molecular approaches to fully understand SUN3's contribution to this process.

What are the methodological considerations for analyzing SUN3 domain trimerization and its functional significance?

SUN domains can form homotrimers, as demonstrated by crystallographic studies of SUN2 . This trimerization is likely critical for SUN3 function as well. To study SUN3 trimerization:

  • Structural biology approaches:

    • Size exclusion chromatography to assess oligomeric state (as shown for SUN2, which exhibits both monomeric and trimeric forms in solution)

    • Analytical ultracentrifugation to determine stoichiometry

    • Cross-linking mass spectrometry to map protein-protein interfaces

    • Blue native PAGE to analyze native complexes

  • Functional assessment of trimerization:

    • Mutagenesis of residues predicted to be involved in trimerization

    • Dominant-negative approaches using trimerization-defective mutants

    • FRET-based assays to monitor oligomerization in living cells

  • Biochemical characterization:

    • In vitro reconstitution of SUN3-KASH complexes with purified components

    • Surface plasmon resonance to measure binding kinetics and affinities

    • Isothermal titration calorimetry to determine thermodynamic parameters

Studies on SUN2 have shown that its SUN domain forms a homotrimer that is critical for KASH domain binding, with certain mutations associated with nuclear migration failure abolishing this interaction . Similar structure-function relationships likely exist for SUN3.

What protein expression systems are optimal for producing recombinant SUN3 for structural and functional studies?

For recombinant expression of SUN3, researchers should consider:

  • Bacterial expression systems:

    • Optimal for producing the soluble SUN domain (aa 72-171) for structural studies

    • Codon optimization for E. coli expression

    • Fusion tags (His, GST, MBP) to improve solubility and facilitate purification

    • Specialized strains for membrane protein expression if including the transmembrane domain

  • Eukaryotic expression systems:

    • Mammalian cell lines (HEK293, CHO) for full-length protein with native post-translational modifications

    • Baculovirus-insect cell system for higher yields of properly folded protein

    • Yeast expression systems for functional complementation studies

Recombinant SUN3 protein fragments, such as the commercially available Human SUN3 (aa 72-171) control fragment, can be useful for antibody validation and as controls in immunological assays . When designing constructs, researchers should consider that the highest sequence identity with mouse and rat orthologs is approximately 72% .

What detection methods are most reliable for SUN3 quantification and localization studies?

For accurate detection and quantification of SUN3:

  • Immunological methods:

    • Western blotting using validated antibodies such as rabbit recombinant monoclonal antibodies

    • ELISA assays with a detection range of 0.156-10 ng/ml for quantitative measurement in tissue homogenates, cell lysates, and biological fluids

    • Immunofluorescence/immunohistochemistry for localization studies

  • Considerations for antibody use:

    • Pre-incubation with protein control fragments (100x molar excess) for blocking experiments

    • Optimization of dilutions for specific applications

    • Validation of antibody specificity using knockdown or knockout controls

  • Storage and stability considerations:

    • ELISA kits should be stored according to manufacturer's instructions, typically at 4°C upon receipt

    • Antibodies may be available in BSA and azide-free formulations for conjugation with fluorochromes, metal isotopes, or enzymes for multiplexed imaging applications

    • Kit stability is typically determined by activity loss rate (<5% within expiration date under appropriate storage)

For quantitative analysis, researchers should note that ELISA kits are optimized for detection of native samples rather than recombinant proteins, as different tertiary structures may affect recognition .

What are the current limitations in SUN3 research and how might they be addressed?

Current challenges in SUN3 research include:

  • Limited structural information:

    • While the structure of SUN2's SUN domain has been determined , comprehensive structural data specific to SUN3 is lacking

    • Future approaches should include cryo-EM studies of the full-length protein in membrane environments

    • Molecular dynamics simulations to predict conformational changes during force transmission

  • Tissue-specific functions:

    • SUN3's specialized roles in spermatogenesis require tissue-specific models and approaches

    • Development of organoid systems or specialized co-culture methods may provide more physiologically relevant contexts

    • Single-cell approaches to capture heterogeneity within testicular cell populations

  • Dynamic regulation:

    • Understanding how SUN3 function is regulated during cellular processes

    • Development of biosensors to monitor SUN3 conformational changes in response to mechanical forces

    • Optogenetic tools to manipulate SUN3 function with spatiotemporal precision

  • Disease relevance:

    • While SUN3 has been associated with certain forms of deafness , more comprehensive phenotypic characterization of SUN3 dysfunction is needed

    • Patient-derived iPSCs could provide valuable insights into disease mechanisms

    • Development of small molecule modulators of SUN3 function for therapeutic exploration

How can emerging technologies advance our understanding of SUN3 biology?

Emerging technologies that could significantly impact SUN3 research include:

  • Advanced imaging techniques:

    • Correlative light and electron microscopy (CLEM) to bridge molecular identification with ultrastructural context

    • Live-cell super-resolution imaging to track SUN3 dynamics at nanoscale resolution

    • Lattice light-sheet microscopy for long-term imaging of nuclear dynamics

  • Genomic and transcriptomic approaches:

    • CRISPR screening to identify genetic interactions with SUN3

    • Spatial transcriptomics to map SUN3 expression patterns in complex tissues

    • Ribosome profiling to assess translational regulation

  • Proteomics innovations:

    • Proximity labeling approaches (TurboID, APEX) to map the SUN3 interaction network

    • Cross-linking mass spectrometry to capture transient interactions

    • Thermal proteome profiling to identify small molecule binders of SUN3

  • Mechanical biology tools:

    • Micropipette aspiration to study nuclear mechanics in SUN3-manipulated cells

    • Atomic force microscopy to measure forces across the nuclear envelope

    • Microfluidic devices to apply controlled mechanical stimuli while monitoring cellular responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.